F207004

General Info

Members Datasets Scaffolds Average Seq Length
149 98 147 279

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0091389|Ga0495672_0091389_168_1166
Length 316
Sequence LNRPKGEMSRPLRLAFPSLKLSGSWFISKFIIVFITKEKVMEFIDYYKVLGLDKNASQEDIKKAYRKLARKYHPDLNPNDKDANKTFQRINEAHEVLSDPEKRKKYDQYGKDWQHAEEFEKARQSRAAGSQRENAFSGMDDEGAFSDFFESMFGSRGRGGQDLKFRGQDYNAELHLSLQDAYTTHQQTLTVNGKNIRITIPAGVENGQVIRLKGHGGPGINGGPNGDLYLTFIIADDPRFRRSGNDLYTKVELDLYTAVLGGEIMVDTLAGKVKGKGFPVYKKEGEAGDLFVTYSIRIPVNLTEKQKELFRQLSKL

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
3 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
93 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
94 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
95 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
96 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
97 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
98 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.05
Nodule 0
Rhizoplane 0.67
Rhizosphere 85.91
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10037171 3300003316 Bacteria 13751
2 rootH2_10146097 3300003320 Bacteria 1189
3 rootH2_10164158 3300003320 Bacteria 1293
4 rootL2_10187590 3300003322 Bacteria 4078
5 rootH1_10000888 3300003323 Bacteria 41861
6 rootH1_10028305 3300003316 Bacteria 1446
7 rootH1_10028305 3300003323 Bacteria 15223
8 Ga0055536_1008735 3300003781 Bacteria 4302
9 Ga0065165_1005716 3300005262 Bacteria 6844
10 Ga0065704_10072855 3300005289 Bacteria 7921
11 Ga0065715_10253687 3300005293 Bacteria 1159
12 Ga0070658_10007175 3300005327 Bacteria 9000
13 Ga0070676_10071595 3300005328 Bacteria 2083
14 Ga0070670_100051160 3300005331 Bacteria 3549
15 Ga0070670_100258084 3300005331 Unclassified 1519
16 Ga0070677_10022818 3300005333 Bacteria 2309
17 Ga0070677_10142535 3300005333 Bacteria 1107
18 Ga0070666_10001692 3300005335 Bacteria 13450
19 Ga0070666_10085790 3300005335 Bacteria 2157
20 Ga0068868_100001409 3300005338 Bacteria 16571
21 Ga0070660_100179734 3300005339 Bacteria 1712
22 Ga0070668_100000736 3300005347 Bacteria 22377
23 Ga0070671_100002242 3300005355 Bacteria 14920
24 Ga0070673_100006808 3300005364 Bacteria 7466
25 Ga0070673_100149313 3300005364 Bacteria 1978
26 Ga0070667_100002471 3300005367 Bacteria 16141
27 Ga0070667_100332337 3300005367 Bacteria 1373
28 Ga0070663_100296748 3300005455 Bacteria 1292
29 Ga0070662_100017654 3300005457 Bacteria 4814
30 Ga0068867_100000714 3300005459 Bacteria 22153
31 Ga0068856_100100901 3300005614 Bacteria 2879
32 Ga0068864_100001831 3300005618 Bacteria 17477
33 Ga0068866_10114496 3300005718 Unclassified 1510
34 Ga0068861_100049766 3300005719 Bacteria 3174
35 Ga0068851_10000961 3300005834 Bacteria 12479
36 Ga0068863_100002737 3300005841 Bacteria 17430
37 Ga0068860_100022516 3300005843 Bacteria 6093
38 Ga0068860_100042855 3300005843 Bacteria 4319
39 Ga0075366_10015033 3300006195 Bacteria 4427
40 Ga0097621_100002889 3300006237 Bacteria 11798
41 Ga0097621_100020540 3300006237 Bacteria 5089
42 Ga0068871_100000741 3300006358 Bacteria 22178
43 Ga0068865_100001459 3300006881 Bacteria 13774
44 Ga0105240_10130692 3300009093 Bacteria 3013
45 Ga0105248_10033244 3300009177 Bacteria 5760
46 Ga0105248_10114160 3300009177 Bacteria 3047
47 Ga0105249_10006552 3300009553 Bacteria 10131
48 Ga0105239_10490544 3300010375 Bacteria 1396
49 Ga0157370_10148510 3300013104 Bacteria 2182
50 Ga0157370_10318406 3300013104 Bacteria 1435
51 Ga0157374_10004538 3300013296 Bacteria 11659
52 Ga0157378_10006732 3300013297 Bacteria 10038
53 Ga0157378_10101060 3300013297 Bacteria 2634
54 Ga0163162_10000120 3300013306 Bacteria 69255
55 Ga0163162_10002095 3300013306 Bacteria 18722
56 Ga0163162_10005617 3300013306 Bacteria 12124
57 Ga0163162_10006680 3300013306 Bacteria 11191
58 Ga0157372_10018536 3300013307 Bacteria 7485
59 Ga0157372_10018578 3300013307 Bacteria 7478
60 Ga0157372_10060614 3300013307 Bacteria 4234
61 Ga0157372_10215266 3300013307 Bacteria 2226
62 Ga0157375_10003373 3300013308 Bacteria 13848
63 Ga0157375_10007999 3300013308 Bacteria 9258
64 Ga0157375_10150913 3300013308 Bacteria 2459
65 Ga0163163_10000526 3300014325 Bacteria 34147
66 Ga0157380_10106748 3300014326 Bacteria 2344
67 Ga0157379_10001164 3300014968 Bacteria 21405
68 Ga0157379_10046493 3300014968 Bacteria 3871
69 Ga0157379_10109250 3300014968 Bacteria 2483
70 Ga0157376_10001182 3300014969 Bacteria 17205
71 Ga0157376_10003039 3300014969 Bacteria 11492
72 Ga0157376_10022275 3300014969 Bacteria 4935
73 Ga0209676_1001625 3300025292 Bacteria 19883
74 Ga0207697_10012625 3300025315 Bacteria 3537
75 Ga0207656_10022564 3300025321 Bacteria 2526
76 Ga0207680_10000842 3300025903 Bacteria 14485
77 Ga0207645_10001186 3300025907 Bacteria 21516
78 Ga0207705_10004271 3300025909 Bacteria 10822
79 Ga0207650_10080692 3300025925 Bacteria 2467
80 Ga0207644_10002179 3300025931 Bacteria 12702
81 Ga0207706_10008900 3300025933 Bacteria 9241
82 Ga0207691_10000753 3300025940 Bacteria 32051
83 Ga0207711_10081083 3300025941 Bacteria 2835
84 Ga0207712_10134177 3300025961 Bacteria 1891
85 Ga0207668_10000432 3300025972 Bacteria 26449
86 Ga0207658_10014175 3300025986 Bacteria 5459
87 Ga0207658_10121135 3300025986 Bacteria 2086
88 Ga0207639_10018518 3300026041 Bacteria 4950
89 Ga0207702_10041661 3300026078 Unclassified 3851
90 Ga0207641_10001804 3300026088 Bacteria 20592
91 Ga0207648_10000768 3300026089 Bacteria 36105
92 Ga0207648_10475109 3300026089 Bacteria 1141
93 Ga0207676_10129455 3300026095 Bacteria 2143
94 Ga0207675_100100538 3300026118 Bacteria 2724
95 Ga0207683_10061958 3300026121 Bacteria 3293
96 Ga0209969_1015833 3300027360 Bacteria 1103
97 Ga0268264_10001719 3300028381 Bacteria 20165
98 Ga0268264_10006688 3300028381 Bacteria 9690
99 Ga0307517_10002960 3300028786 Bacteria 26831
100 Ga0265327_10002428 3300031251 Bacteria 19683
101 Ga0307516_10000659 3300031730 Bacteria 46694
102 Ga0307405_10000007 3300031731 Bacteria 348101
103 Ga0307405_10088810 3300031731 Bacteria 2040
104 Ga0307406_10238658 3300031901 Bacteria 1362
105 Ga0307412_10034171 3300031911 Bacteria 3239
106 Ga0307414_10001185 3300032004 Bacteria 13390
107 Ga0316582_0040569 3300036647 Bacteria 2906
108 Ga0451577_0000015 3300042876 Bacteria 538333
109 Ga0451577_0000034 3300042876 Bacteria 376183
110 Ga0451577_0019396 3300042876 Bacteria 6254
111 Ga0451577_0051778 3300042876 Bacteria 3666
112 Ga0451577_0070349 3300042876 Bacteria 3121
113 Ga0451577_0144613 3300042876 Bacteria 2138
114 Ga0451577_0206238 3300042876 Bacteria 1775
115 Ga0466972_0000021 3300044658 Bacteria 196266
116 Ga0453683_0000122 3300044673 Bacteria 116184
117 Ga0453683_0003921 3300044673 Bacteria 10778
118 Ga0453684_0000081 3300044712 Bacteria 402985
119 Ga0453684_0000086 3300044712 Bacteria 397278
120 Ga0453684_0000098 3300044712 Bacteria 376183
121 Ga0453684_0000165 3300044712 Bacteria 294572
122 Ga0453684_0000660 3300044712 Bacteria 123924
123 Ga0453684_0006366 3300044712 Bacteria 22501
124 Ga0453684_0020764 3300044712 Bacteria 9874
125 Ga0453684_0055195 3300044712 Bacteria 5166
126 Ga0453684_0264046 3300044712 Bacteria 1971
127 Ga0453684_0299683 3300044712 Bacteria 1827
128 Ga0451576_0000036 3300045051 Bacteria 376183
129 Ga0451576_0000506 3300045051 Bacteria 85303
130 Ga0451576_0054788 3300045051 Bacteria 4174
131 Ga0451576_0342609 3300045051 Unclassified 1565
132 Ga0451576_0414090 3300045051 Bacteria 1414
133 Ga0451576_0430524 3300045051 Unclassified 1384
134 Ga0495672_0058963 3300047320 Bacteria 2223
135 Ga0495672_0091389 3300047320 Bacteria 1671
136 Ga0496108_0065119 3300048911 Bacteria 3072
137 Ga0501033_0295750 3300049570 Unclassified 1141
138 Ga0501040_0010827 3300049576 Bacteria 5962
139 Ga0501043_0045772 3300049579 Bacteria 3441
140 nmdc:mga0k408_130186_c1 3300050493 Bacteria 1494
141 nmdc:mga0k408_33722_c1 3300050493 Bacteria 2929
142 Ga0500646_0006085 3300053090 Bacteria 3064
143 Ga0500569_000258 3300053109 Bacteria 8403
144 Ga0500559_0006366 3300053136 Bacteria 5333
145 Ga0500577_0000636 3300053142 Bacteria 9000
146 Ga0500590_034191 3300053148 Bacteria 2632
147 Ga0500636_0012271 3300053177 Bacteria 5020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10318406 Ga0157370_103184062 215
2 3300013307 Ga0157372_10215266 Ga0157372_102152664 216
3 3300003320 rootH2_10164158 rootH2_101641582 217
4 3300050493 nmdc:mga0k408_33722_c1 nmdc:mga0k408_33722_c1_976_1857 221
5 3300053136 Ga0500559_0006366 Ga0500559_0006366_4286_5179 226
6 3300053177 Ga0500636_0012271 Ga0500636_0012271_4066_4959 226
7 3300042876 Ga0451577_0000034 Ga0451577_0000034_246436_247320 228
8 3300042876 Ga0451577_0051778 Ga0451577_0051778_11_898 228
9 3300044673 Ga0453683_0000122 Ga0453683_0000122_4640_5524 228
10 3300044712 Ga0453684_0000098 Ga0453684_0000098_246436_247320 228
11 3300045051 Ga0451576_0000036 Ga0451576_0000036_128864_129748 228
12 3300049570 Ga0501033_0295750 Ga0501033_0295750_197_1117 228
13 3300031731 Ga0307405_10088810 Ga0307405_100888101 230
14 3300045051 Ga0451576_0414090 Ga0451576_0414090_291_1172 231
15 3300044712 Ga0453684_0299683 Ga0453684_0299683_558_1436 232
16 3300053148 Ga0500590_034191 Ga0500590_034191_1166_2059 233
17 3300031911 Ga0307412_10034171 Ga0307412_100341714 235
18 3300032004 Ga0307414_10001185 Ga0307414_1000118513 235
19 3300003781 Ga0055536_1008735 Ga0055536_10087355 237
20 3300005262 Ga0065165_1005716 Ga0065165_10057165 237
21 3300025292 Ga0209676_1001625 Ga0209676_10016256 237
22 3300031731 Ga0307405_10000007 Ga0307405_10000007227 237
23 3300049579 Ga0501043_0045772 Ga0501043_0045772_2213_3106 237
24 3300044712 Ga0453684_0000086 Ga0453684_0000086_155934_156830 241
25 3300042876 Ga0451577_0144613 Ga0451577_0144613_562_1455 242
26 3300045051 Ga0451576_0054788 Ga0451576_0054788_1900_2787 244
27 3300048911 Ga0496108_0065119 Ga0496108_0065119_1806_2717 246
28 3300053090 Ga0500646_0006085 Ga0500646_0006085_2112_3008 246
29 3300053142 Ga0500577_0000636 Ga0500577_0000636_7712_8608 246
30 3300005339 Ga0070660_100179734 Ga0070660_1001797342 249
31 3300013307 Ga0157372_10060614 Ga0157372_100606144 249
32 3300053109 Ga0500569_000258 Ga0500569_000258_4080_4976 250
33 3300044658 Ga0466972_0000021 Ga0466972_0000021_3931_4836 252
34 3300005293 Ga0065715_10253687 Ga0065715_102536871 253
35 3300005333 Ga0070677_10142535 Ga0070677_101425351 253
36 3300014969 Ga0157376_10001182 Ga0157376_1000118210 253
37 3300026089 Ga0207648_10475109 Ga0207648_104751092 253
38 3300005331 Ga0070670_100051160 Ga0070670_1000511601 254
39 3300005333 Ga0070677_10022818 Ga0070677_100228184 254
40 3300025925 Ga0207650_10080692 Ga0207650_100806922 254
41 3300044712 Ga0453684_0264046 Ga0453684_0264046_217_1107 255
42 3300049576 Ga0501040_0010827 Ga0501040_0010827_1885_2805 255
43 3300031730 Ga0307516_10000659 Ga0307516_100006592 257
44 3300042876 Ga0451577_0206238 Ga0451577_0206238_188_1075 258
45 3300005614 Ga0068856_100100901 Ga0068856_1001009012 259
46 3300005718 Ga0068866_10114496 Ga0068866_101144963 259
47 3300026078 Ga0207702_10041661 Ga0207702_100416615 259
48 3300044712 Ga0453684_0055195 Ga0453684_0055195_2956_3804 259
49 3300005289 Ga0065704_10072855 Ga0065704_100728559 260
50 3300013104 Ga0157370_10148510 Ga0157370_101485102 260
51 3300031901 Ga0307406_10238658 Ga0307406_102386581 260
52 3300005327 Ga0070658_10007175 Ga0070658_100071758 261
53 3300005328 Ga0070676_10071595 Ga0070676_100715952 261
54 3300005335 Ga0070666_10001692 Ga0070666_1000169212 261
55 3300005338 Ga0068868_100001409 Ga0068868_10000140911 261
56 3300005347 Ga0070668_100000736 Ga0070668_1000007368 261
57 3300005364 Ga0070673_100006808 Ga0070673_1000068083 261
58 3300005367 Ga0070667_100002471 Ga0070667_1000024712 261
59 3300005457 Ga0070662_100017654 Ga0070662_1000176543 261
60 3300005459 Ga0068867_100000714 Ga0068867_1000007144 261
61 3300005618 Ga0068864_100001831 Ga0068864_1000018318 261
62 3300005719 Ga0068861_100049766 Ga0068861_1000497663 261
63 3300005834 Ga0068851_10000961 Ga0068851_100009613 261
64 3300005841 Ga0068863_100002737 Ga0068863_10000273712 261
65 3300005843 Ga0068860_100022516 Ga0068860_1000225163 261
66 3300006237 Ga0097621_100002889 Ga0097621_1000028894 261
67 3300006881 Ga0068865_100001459 Ga0068865_1000014592 261
68 3300009093 Ga0105240_10130692 Ga0105240_101306922 261
69 3300009177 Ga0105248_10114160 Ga0105248_101141606 261
70 3300013296 Ga0157374_10004538 Ga0157374_100045382 261
71 3300013297 Ga0157378_10006732 Ga0157378_1000673212 261
72 3300013306 Ga0163162_10002095 Ga0163162_100020952 261
73 3300013308 Ga0157375_10007999 Ga0157375_100079999 261
74 3300014325 Ga0163163_10000526 Ga0163163_1000052611 261
75 3300014968 Ga0157379_10001164 Ga0157379_1000116423 261
76 3300014969 Ga0157376_10022275 Ga0157376_100222755 261
77 3300025315 Ga0207697_10012625 Ga0207697_100126252 261
78 3300025321 Ga0207656_10022564 Ga0207656_100225643 261
79 3300025903 Ga0207680_10000842 Ga0207680_1000084218 261
80 3300025907 Ga0207645_10001186 Ga0207645_1000118613 261
81 3300025909 Ga0207705_10004271 Ga0207705_100042715 261
82 3300025933 Ga0207706_10008900 Ga0207706_100089005 261
83 3300025940 Ga0207691_10000753 Ga0207691_1000075312 261
84 3300025961 Ga0207712_10134177 Ga0207712_101341772 261
85 3300025972 Ga0207668_10000432 Ga0207668_1000043221 261
86 3300025986 Ga0207658_10014175 Ga0207658_100141753 261
87 3300026088 Ga0207641_10001804 Ga0207641_1000180417 261
88 3300026089 Ga0207648_10000768 Ga0207648_1000076817 261
89 3300026095 Ga0207676_10129455 Ga0207676_101294552 261
90 3300026118 Ga0207675_100100538 Ga0207675_1001005381 261
91 3300028381 Ga0268264_10001719 Ga0268264_1000171921 261
92 3300005843 Ga0068860_100042855 Ga0068860_1000428555 262
93 3300006195 Ga0075366_10015033 Ga0075366_100150334 262
94 3300013306 Ga0163162_10000120 Ga0163162_100001205 262
95 3300026041 Ga0207639_10018518 Ga0207639_100185188 262
96 3300028381 Ga0268264_10006688 Ga0268264_1000668810 262
97 3300050493 nmdc:mga0k408_130186_c1 nmdc:mga0k408_130186_c1_270_1154 262
98 3300003323 rootH1_10000888 rootH1_1000088821 263
99 3300005335 Ga0070666_10085790 Ga0070666_100857902 263
100 3300005355 Ga0070671_100002242 Ga0070671_10000224210 263
101 3300005364 Ga0070673_100149313 Ga0070673_1001493133 263
102 3300005367 Ga0070667_100332337 Ga0070667_1003323372 263
103 3300006237 Ga0097621_100020540 Ga0097621_1000205402 263
104 3300006358 Ga0068871_100000741 Ga0068871_10000074112 263
105 3300009177 Ga0105248_10033244 Ga0105248_100332443 263
106 3300013297 Ga0157378_10101060 Ga0157378_101010602 263
107 3300013306 Ga0163162_10006680 Ga0163162_100066809 263
108 3300013308 Ga0157375_10003373 Ga0157375_100033739 263
109 3300014968 Ga0157379_10046493 Ga0157379_100464934 263
110 3300014969 Ga0157376_10003039 Ga0157376_100030399 263
111 3300025931 Ga0207644_10002179 Ga0207644_100021799 263
112 3300025941 Ga0207711_10081083 Ga0207711_100810834 263
113 3300025986 Ga0207658_10121135 Ga0207658_101211352 263
114 3300026121 Ga0207683_10061958 Ga0207683_100619582 263
115 3300027360 Ga0209969_1015833 Ga0209969_10158331 263
116 3300044673 Ga0453683_0003921 Ga0453683_0003921_9842_10741 263
117 3300045051 Ga0451576_0430524 Ga0451576_0430524_370_1269 263
118 3300005331 Ga0070670_100258084 Ga0070670_1002580842 264
119 3300013307 Ga0157372_10018578 Ga0157372_100185781 265
120 3300044712 Ga0453684_0000660 Ga0453684_0000660_38813_39700 266
121 iso_pu_bacteria 2522125168 2522552799 266
122 iso_pu_bacteria 2881247448 2881249537 267
123 iso_pu_bacteria 2881955468 2881955660 268
124 3300044712 Ga0453684_0000165 Ga0453684_0000165_207425_208336 269
125 3300028786 Ga0307517_10002960 Ga0307517_1000296015 270
126 3300031251 Ga0265327_10002428 Ga0265327_100024286 270
127 3300010375 Ga0105239_10490544 Ga0105239_104905441 271
128 3300014326 Ga0157380_10106748 Ga0157380_101067482 271
129 3300042876 Ga0451577_0019396 Ga0451577_0019396_4981_5871 271
130 3300042876 Ga0451577_0070349 Ga0451577_0070349_1778_2695 271
131 3300044712 Ga0453684_0006366 Ga0453684_0006366_20469_21359 271
132 3300044712 Ga0453684_0020764 Ga0453684_0020764_6798_7715 271
133 3300045051 Ga0451576_0342609 Ga0451576_0342609_199_1116 271
134 3300047320 Ga0495672_0091389 Ga0495672_0091389_168_1166 271
135 3300005455 Ga0070663_100296748 Ga0070663_1002967481 272
136 3300013307 Ga0157372_10018536 Ga0157372_1001853610 272
137 3300042876 Ga0451577_0000015 Ga0451577_0000015_378106_379005 272
138 3300044712 Ga0453684_0000081 Ga0453684_0000081_195600_196499 272
139 3300045051 Ga0451576_0000506 Ga0451576_0000506_80843_81742 272
140 3300047320 Ga0495672_0058963 Ga0495672_0058963_24_905 272
141 3300009553 Ga0105249_10006552 Ga0105249_100065523 273
142 3300013306 Ga0163162_10005617 Ga0163162_100056175 273
143 3300013308 Ga0157375_10150913 Ga0157375_101509132 273
144 3300014968 Ga0157379_10109250 Ga0157379_101092502 273
145 3300036647 Ga0316582_0040569 Ga0316582_0040569_806_1750 274
146 3300003316 rootH1_10037171 rootH1_100371719 275
147 3300003320 rootH2_10146097 rootH2_101460971 275
148 3300003322 rootL2_10187590 rootL2_101875904 275
149 3300003323 rootH1_10028305 rootH1_100283058 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

45

107

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

170

299

0.93

Feature Viewer

pLDDT pTM Quality
79.4 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map