F206200

General Info

Members Datasets Scaffolds Average Seq Length
149 107 298 280

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10283407|Ga0207700_102834072
Length 295
Sequence VAKLGFSLFTRAKAGYSGIISVRMAEDMGMEAIFGQLLDGAATARLFAQHGAHVVIVDNDIDLAQRTTDEITTSGGSALPVVTDVRDANQVAGLARAVLDRYGRIDVLVNNVGHWLRHPGNFVDTDPQLWDELYRINLHHVFLVTHAFLPAMIHQRRGAIVNVSSVEGLRGYPEDPVYAAFKAAVIHFTRSLAVQVGRDGVRVNGIGPDVTESLQVPYSQWLSAEEQTQWPQWVPVGRMGLPEDQARVILFLASDLSAFVTGHTIPTDGGTGAAGGWFRSSRRADREWTNRPIAP

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
57 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
58 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
59 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
73 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
74 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
77 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
78 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
84 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
92 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.71
Nodule 0
Rhizoplane 8.72
Rhizosphere 75.84
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10283407 3300025928 Bacteria 1426
2 Ga0070676_10203776 3300005328 Bacteria 1298
3 Ga0070683_100107008 3300005329 Bacteria 2637
4 Ga0070670_100078724 3300005331 Bacteria 2832
5 Ga0070675_100225262 3300005354 Bacteria 1634
6 Ga0070671_100000399 3300005355 Bacteria 29938
7 Ga0070673_100284267 3300005364 Bacteria 1452
8 Ga0070688_100410793 3300005365 Bacteria 1004
9 Ga0070709_10150278 3300005434 Bacteria 1609
10 Ga0070714_100008686 3300005435 Bacteria 7943
11 Ga0070714_100104287 3300005435 Bacteria 2502
12 Ga0070713_100092434 3300005436 Bacteria 2605
13 Ga0070710_10159101 3300005437 Bacteria 1399
14 Ga0070665_100237040 3300005548 Unclassified 1825
15 Ga0068855_100192282 3300005563 Bacteria 2301
16 Ga0068859_100071021 3300005617 Bacteria 3517
17 Ga0068861_100153137 3300005719 Bacteria 1894
18 Ga0068858_100008064 3300005842 Bacteria 10142
19 Ga0081455_10184512 3300005937 Bacteria 1577
20 Ga0081539_10010595 3300005985 Bacteria 7450
21 Ga0075363_100003459 3300006048 Bacteria 6716
22 Ga0075364_10006627 3300006051 Bacteria 6821
23 Ga0075364_10007976 3300006051 Bacteria 6308
24 Ga0070716_100127371 3300006173 Bacteria 1604
25 Ga0075369_10018696 3300006186 Bacteria 2824
26 Ga0075369_10168289 3300006186 Bacteria 1006
27 Ga0075370_10120958 3300006353 Bacteria 1524
28 Ga0075434_100487923 3300006871 Bacteria 1253
29 Ga0097620_100071021 3300006931 Bacteria 3517
30 Ga0105242_10439848 3300009176 Bacteria 1226
31 Ga0105248_10479919 3300009177 Unclassified 1401
32 Ga0105237_10183503 3300009545 Bacteria 2092
33 Ga0105238_10141226 3300009551 Bacteria 2385
34 Ga0105238_10550658 3300009551 Bacteria 1158
35 Ga0105239_10100064 3300010375 Bacteria 3206
36 Ga0105239_10415341 3300010375 Bacteria 1524
37 Ga0157370_10164065 3300013104 Bacteria 2067
38 Ga0213876_10001276 3300021384 Bacteria 15892
39 Ga0213876_10023175 3300021384 Bacteria 3280
40 Ga0213875_10105533 3300021388 Bacteria 1315
41 Ga0207695_10241675 3300025913 Bacteria 1707
42 Ga0207671_10178413 3300025914 Unclassified 1652
43 Ga0207694_10033793 3300025924 Bacteria 3918
44 Ga0207694_10361676 3300025924 Unclassified 1203
45 Ga0207650_10061223 3300025925 Bacteria 2810
46 Ga0207664_10020321 3300025929 Bacteria 4919
47 Ga0207644_10001153 3300025931 Bacteria 16935
48 Ga0207665_10207061 3300025939 Bacteria 1431
49 Ga0207661_10249270 3300025944 Bacteria 1578
50 Ga0207651_10164573 3300025960 Bacteria 1743
51 Ga0207668_10537181 3300025972 Unclassified 1011
52 Ga0207677_10386268 3300026023 Bacteria 1183
53 Ga0207703_10005581 3300026035 Bacteria 10098
54 Ga0207675_100080184 3300026118 Bacteria 3060
55 Ga0207675_100511147 3300026118 Bacteria 1197
56 Ga0207683_10460879 3300026121 Bacteria 1172
57 Ga0268266_10243950 3300028379 Unclassified 1659
58 Ga0265334_10108768 3300028573 Bacteria 998
59 Ga0265338_10023089 3300028800 Bacteria 6407
60 Ga0265327_10035935 3300031251 Bacteria 2730
61 Ga0265327_10077546 3300031251 Bacteria 1648
62 Ga0316576_10003141 3300031727 Bacteria 9630
63 Ga0316576_10189360 3300031727 Bacteria 1551
64 Ga0316578_10082615 3300031728 Bacteria 1913
65 Ga0307416_100154596 3300032002 Bacteria 2110
66 Ga0316574_0038396 3300035398 Bacteria 2939
67 Ga0316574_0076788 3300035398 Bacteria 2116
68 Ga0373931_0129411 3300035691 Bacteria 1451
69 Ga0316584_0007064 3300036712 Bacteria 7646
70 Ga0436364_0154072 3300037853 Bacteria 15306
71 Ga0436365_0162530 3300039437 Bacteria 13545
72 Ga0436365_0529637 3300039437 Bacteria 32938
73 Ga0436365_1206499 3300039437 Bacteria 7399
74 Ga0436365_1823845 3300039437 Bacteria 75216
75 Ga0436363_0879201 3300039450 Bacteria 986
76 Ga0466966_0019392 3300044684 Bacteria 4475
77 Ga0466966_0036022 3300044684 Bacteria 3196
78 Ga0466961_0006293 3300044693 Bacteria 7540
79 Ga0466963_0007368 3300044694 Bacteria 6554
80 Ga0466963_0099072 3300044694 Bacteria 1993
81 Ga0466963_0099172 3300044694 Bacteria 1992
82 Ga0466963_0163674 3300044694 Bacteria 1549
83 Ga0466968_0018650 3300044735 Bacteria 2785
84 Ga0466970_0010460 3300044765 Bacteria 4711
85 Ga0466957_0071215 3300044842 Bacteria 2150
86 Ga0466957_0163026 3300044842 Bacteria 1449
87 Ga0466957_0278012 3300044842 Bacteria 1120
88 Ga0466960_0001726 3300044901 Bacteria 8024
89 Ga0466959_0006847 3300045049 Bacteria 7945
90 Ga0466958_0042209 3300045836 Bacteria 2746
91 Ga0466958_0167322 3300045836 Bacteria 1391
92 Ga0466967_0002483 3300045976 Bacteria 11513
93 Ga0466967_0007071 3300045976 Bacteria 8041
94 Ga0466967_0007116 3300045976 Bacteria 8028
95 Ga0466967_0028591 3300045976 Bacteria 4656
96 Ga0466967_0054162 3300045976 Bacteria 3529
97 Ga0466967_0214395 3300045976 Bacteria 1827
98 Ga0466967_0757064 3300045976 Bacteria 963
99 Ga0495608_0049503 3300046511 Bacteria 2790
100 Ga0495657_0153609 3300046675 Bacteria 1428
101 Ga0496100_0031570 3300048903 Bacteria 3295
102 Ga0496102_0085052 3300048905 Bacteria 2920
103 Ga0496104_0023636 3300048907 Bacteria 5652
104 Ga0496105_0083255 3300048908 Bacteria 2642
105 Ga0496107_0075216 3300048910 Bacteria 2458
106 Ga0496108_0392647 3300048911 Bacteria 1212
107 Ga0496110_0312915 3300048913 Bacteria 1430
108 Ga0496110_0451318 3300048913 Bacteria 1172
109 Ga0496113_0320233 3300048916 Bacteria 1243
110 Ga0496114_0035411 3300048917 Bacteria 4122
111 Ga0496114_0451858 3300048917 Bacteria 1138
112 Ga0496115_0020818 3300048918 Bacteria 5062
113 Ga0496115_0135733 3300048918 Bacteria 2029
114 Ga0496118_0000854 3300048921 Bacteria 48318
115 Ga0496126_0000048 3300048929 Bacteria 317977
116 Ga0496126_0013281 3300048929 Bacteria 8392
117 Ga0496126_0126061 3300048929 Bacteria 2216
118 Ga0501033_0084375 3300049570 Bacteria 2328
119 Ga0501034_0002710 3300049571 Bacteria 20871
120 Ga0501046_0004668 3300049580 Bacteria 12366
121 Ga0501046_0011231 3300049580 Bacteria 7668
122 Ga0501047_0001776 3300049581 Bacteria 20842
123 Ga0501047_0072384 3300049581 Bacteria 3318
124 Ga0501047_0476315 3300049581 Bacteria 1076
125 Ga0501048_0002237 3300049582 Bacteria 14744
126 Ga0501067_0093458 3300049583 Bacteria 1670
127 Ga0501069_0023401 3300049585 Bacteria 3369
128 Ga0501070_0005660 3300049586 Bacteria 10652
129 Ga0501070_0039391 3300049586 Bacteria 3942
130 Ga0501070_0048893 3300049586 Bacteria 3512
131 Ga0501073_0195453 3300049589 Bacteria 1399
132 Ga0501074_0015686 3300049590 Bacteria 5507
133 Ga0501074_0171229 3300049590 Bacteria 1550
134 Ga0501079_0004181 3300049741 Bacteria 10699
135 Ga0501080_0052298 3300049742 Bacteria 3802
136 Ga0501080_0124881 3300049742 Bacteria 2384
137 Ga0501035_0006147 3300049822 Bacteria 11304
138 Ga0501044_0030667 3300049823 Bacteria 5664
139 Ga0501044_0173988 3300049823 Bacteria 2123
140 nmdc:mga03n38_155574_c1 3300050490 Bacteria 1154
141 nmdc:mga00v17_25096_c1 3300050491 Bacteria 3462
142 nmdc:mga00v17_35606_c1 3300050491 Bacteria 2964
143 nmdc:mga07m45_3323_c1 3300050496 Bacteria 7748
144 nmdc:mga0n895_634907_c1 3300050512 Bacteria 1068
145 Ga0495601_0027242 3300053077 Bacteria 3533
146 Ga0495601_0197759 3300053077 Bacteria 1314
147 Ga0495595_0043616 3300053084 Bacteria 2058
148 Ga0495619_0010744 3300053085 Bacteria 5762
149 Ga0466962_0051417 3300061719 Bacteria 1970
150 Ga0207700_10283407
151 Ga0070676_10203776
152 Ga0070683_100107008
153 Ga0070670_100078724
154 Ga0070675_100225262
155 Ga0070671_100000399
156 Ga0070673_100284267
157 Ga0070688_100410793
158 Ga0070709_10150278
159 Ga0070714_100008686
160 Ga0070714_100104287
161 Ga0070713_100092434
162 Ga0070710_10159101
163 Ga0070665_100237040
164 Ga0068855_100192282
165 Ga0068859_100071021
166 Ga0068861_100153137
167 Ga0068858_100008064
168 Ga0081455_10184512
169 Ga0081539_10010595
170 Ga0075363_100003459
171 Ga0075364_10006627
172 Ga0075364_10007976
173 Ga0070716_100127371
174 Ga0075369_10018696
175 Ga0075369_10168289
176 Ga0075370_10120958
177 Ga0075434_100487923
178 Ga0097620_100071021
179 Ga0105242_10439848
180 Ga0105248_10479919
181 Ga0105237_10183503
182 Ga0105238_10141226
183 Ga0105238_10550658
184 Ga0105239_10100064
185 Ga0105239_10415341
186 Ga0157370_10164065
187 Ga0213876_10001276
188 Ga0213876_10023175
189 Ga0213875_10105533
190 Ga0207695_10241675
191 Ga0207671_10178413
192 Ga0207694_10033793
193 Ga0207694_10361676
194 Ga0207650_10061223
195 Ga0207664_10020321
196 Ga0207644_10001153
197 Ga0207665_10207061
198 Ga0207661_10249270
199 Ga0207651_10164573
200 Ga0207668_10537181
201 Ga0207677_10386268
202 Ga0207703_10005581
203 Ga0207675_100080184
204 Ga0207675_100511147
205 Ga0207683_10460879
206 Ga0268266_10243950
207 Ga0265334_10108768
208 Ga0265338_10023089
209 Ga0265327_10035935
210 Ga0265327_10077546
211 Ga0316576_10003141
212 Ga0316576_10189360
213 Ga0316578_10082615
214 Ga0307416_100154596
215 Ga0316574_0038396
216 Ga0316574_0076788
217 Ga0373931_0129411
218 Ga0316584_0007064
219 Ga0436364_0154072
220 Ga0436365_0162530
221 Ga0436365_0529637
222 Ga0436365_1206499
223 Ga0436365_1823845
224 Ga0436363_0879201
225 Ga0466966_0019392
226 Ga0466966_0036022
227 Ga0466961_0006293
228 Ga0466963_0007368
229 Ga0466963_0099072
230 Ga0466963_0099172
231 Ga0466963_0163674
232 Ga0466968_0018650
233 Ga0466970_0010460
234 Ga0466957_0071215
235 Ga0466957_0163026
236 Ga0466957_0278012
237 Ga0466960_0001726
238 Ga0466959_0006847
239 Ga0466958_0042209
240 Ga0466958_0167322
241 Ga0466967_0002483
242 Ga0466967_0007071
243 Ga0466967_0007116
244 Ga0466967_0028591
245 Ga0466967_0054162
246 Ga0466967_0214395
247 Ga0466967_0757064
248 Ga0495608_0049503
249 Ga0495657_0153609
250 Ga0496100_0031570
251 Ga0496102_0085052
252 Ga0496104_0023636
253 Ga0496105_0083255
254 Ga0496107_0075216
255 Ga0496108_0392647
256 Ga0496110_0312915
257 Ga0496110_0451318
258 Ga0496113_0320233
259 Ga0496114_0035411
260 Ga0496114_0451858
261 Ga0496115_0020818
262 Ga0496115_0135733
263 Ga0496118_0000854
264 Ga0496126_0000048
265 Ga0496126_0013281
266 Ga0496126_0126061
267 Ga0501033_0084375
268 Ga0501034_0002710
269 Ga0501046_0004668
270 Ga0501046_0011231
271 Ga0501047_0001776
272 Ga0501047_0072384
273 Ga0501047_0476315
274 Ga0501048_0002237
275 Ga0501067_0093458
276 Ga0501069_0023401
277 Ga0501070_0005660
278 Ga0501070_0039391
279 Ga0501070_0048893
280 Ga0501073_0195453
281 Ga0501074_0015686
282 Ga0501074_0171229
283 Ga0501079_0004181
284 Ga0501080_0052298
285 Ga0501080_0124881
286 Ga0501035_0006147
287 Ga0501044_0030667
288 Ga0501044_0173988
289 nmdc:mga03n38_155574_c1
290 nmdc:mga00v17_25096_c1
291 nmdc:mga00v17_35606_c1
292 nmdc:mga07m45_3323_c1
293 nmdc:mga0n895_634907_c1
294 Ga0495601_0027242
295 Ga0495601_0197759
296 Ga0495595_0043616
297 Ga0495619_0010744
298 Ga0466962_0051417

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

40

219

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

40

272

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sbw-assembly2.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (apo, orthorhombic form) 0.9438 19 253
8sbw-assembly1.cif.gz_A crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (apo, orthorhombic form) 0.9393 19 253
8sbv-assembly2.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (adp bound) 0.9378 19 258
1uzl-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.9328 23 258
1uzn-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.9326 23 258
ID Description Score Start End Superfamily
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9294 19 253 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9281 21 197 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9261 16 197 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9256 22 192 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9249 12 189 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y0EPA4-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9459 16 253 GO:0016616
GO:0030497
AF-A0A117S3X7-F1-model_v4 Cyclopentanol dehydrogenase 0.9454 17 258 GO:0016491
AF-A0A1X9YKR8-F1-model_v4 Short-chain dehydrogenase 0.945 18 252 GO:0016491
AF-A0A2V9I3R1-F1-model_v4 SDR family oxidoreductase 0.9423 14 253 GO:0016616
AF-A0A7D4IRY4-F1-model_v4 SDR family oxidoreductase 0.9422 13 253 GO:0016616

Map