F206116

General Info

Members Datasets Scaffolds Average Seq Length
149 69 298 121

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10070385|Ga0213874_100703852
Length 137
Sequence VYYRAGAGFGGADATPPSKLQYTMAQTKRKRRTKHRGTAAGTIETRGRTGRPPTAEERKKQSRAEARERRLNTPPTWKRSAAIAAFASVALFLVFSLLGRGKNAAGAFVLYTPTGYYLELAMYRRRQKRKQQPQVPK

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
9 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
10 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
15 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
16 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
17 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
18 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
19 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
20 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
28 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
29 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
30 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
31 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
32 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
33 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
34 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
37 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
40 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
41 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
42 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
43 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
44 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
45 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
46 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
49 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
53 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
58 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
59 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
60 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
61 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
62 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
65 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
66 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
67 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
68 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
69 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 0
Rhizosphere 77.85
Stem 0
Stem Tuber 0
Unclassified 7.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10070385 3300021377 Bacteria 1115
2 Ga0068868_100884196 3300005338 Bacteria 811
3 Ga0068868_101977169 3300005338 Bacteria 553
4 Ga0070692_10790091 3300005345 Bacteria 647
5 Ga0070674_100828238 3300005356 Bacteria 801
6 Ga0070688_100134146 3300005365 Bacteria 1674
7 Ga0070678_100422635 3300005456 Archaea 1162
8 Ga0070684_100161488 3300005535 Archaea 2033
9 Ga0070664_100419336 3300005564 Bacteria 1226
10 Ga0070702_100916977 3300005615 Bacteria 687
11 Ga0081540_1107267 3300005983 Bacteria 1189
12 Ga0070717_10842851 3300006028 Bacteria 834
13 Ga0075432_10589490 3300006058 Bacteria 507
14 Ga0075367_11088821 3300006178 Unclassified 511
15 Ga0068865_100983515 3300006881 Bacteria 738
16 Ga0105248_13141188 3300009177 Bacteria 526
17 Ga0157375_12844647 3300013308 Unclassified 578
18 Ga0157380_10937836 3300014326 Bacteria 895
19 Ga0213873_10021949 3300021358 Bacteria 1507
20 Ga0213876_10025076 3300021384 Bacteria 3147
21 Ga0213876_10060983 3300021384 Bacteria 1990
22 Ga0213876_10236513 3300021384 Bacteria 971
23 Ga0213875_10005359 3300021388 Bacteria 6895
24 Ga0213875_10047198 3300021388 Bacteria 2020
25 Ga0213875_10246533 3300021388 Bacteria 842
26 Ga0207426_1060575 3300025302 Bacteria 1090
27 Ga0207688_10541727 3300025901 Bacteria 731
28 Ga0207669_11283243 3300025937 Unclassified 622
29 Ga0207704_10706675 3300025938 Bacteria 835
30 Ga0207679_10937180 3300025945 Bacteria 793
31 Ga0207677_10397009 3300026023 Bacteria 1168
32 Ga0307408_100113727 3300031548 Bacteria 2084
33 Ga0307408_100774326 3300031548 Bacteria 869
34 Ga0307408_101709255 3300031548 Bacteria 600
35 Ga0307405_10091692 3300031731 Bacteria 2014
36 Ga0307405_10234643 3300031731 Bacteria 1355
37 Ga0307405_10717972 3300031731 Bacteria 829
38 Ga0307413_10024389 3300031824 Bacteria 3297
39 Ga0307413_10479839 3300031824 Bacteria 994
40 Ga0307413_11138713 3300031824 Bacteria 676
41 Ga0307410_10008387 3300031852 Bacteria 5726
42 Ga0307410_10708887 3300031852 Bacteria 849
43 Ga0307406_10006639 3300031901 Bacteria 6394
44 Ga0307406_10087271 3300031901 Bacteria 2091
45 Ga0307406_11950355 3300031901 Bacteria 524
46 Ga0307407_10034584 3300031903 Bacteria 2768
47 Ga0307407_10150261 3300031903 Bacteria 1513
48 Ga0307407_11332558 3300031903 Bacteria 564
49 Ga0307412_10269886 3300031911 Bacteria 1331
50 Ga0307412_11751124 3300031911 Bacteria 570
51 Ga0307409_100010616 3300031995 Bacteria 5741
52 Ga0307409_100022180 3300031995 Bacteria 4371
53 Ga0307409_100298376 3300031995 Bacteria 1498
54 Ga0307409_101042727 3300031995 Bacteria 837
55 Ga0307416_100211340 3300032002 Bacteria 1851
56 Ga0307416_101204627 3300032002 Bacteria 863
57 Ga0307416_102139341 3300032002 Bacteria 661
58 Ga0307414_10130312 3300032004 Bacteria 1951
59 Ga0307414_10719964 3300032004 Bacteria 905
60 Ga0307411_10155922 3300032005 Bacteria 1703
61 Ga0307415_100002014 3300032126 Bacteria 10007
62 Ga0307415_100026243 3300032126 Bacteria 3671
63 Ga0307415_100120496 3300032126 Bacteria 1966
64 Ga0307415_100699446 3300032126 Bacteria 914
65 Ga0307415_101228321 3300032126 Bacteria 707
66 Ga0307415_102042684 3300032126 Bacteria 559
67 Ga0436364_0246061 3300037853 Bacteria 9161
68 Ga0436364_0509412 3300037853 Bacteria 4161
69 Ga0436364_0567381 3300037853 Bacteria 740
70 Ga0436364_0576767 3300037853 Bacteria 1255
71 Ga0436364_1234933 3300037853 Bacteria 2275
72 Ga0436364_1287903 3300037853 Bacteria 947
73 Ga0436364_1454144 3300037853 Bacteria 9318
74 Ga0436364_1473245 3300037853 Bacteria 619
75 Ga0436365_0095352 3300039437 Bacteria 1169
76 Ga0436365_0364096 3300039437 Bacteria 1420
77 Ga0436365_0416351 3300039437 Bacteria 35590
78 Ga0436365_0806257 3300039437 Bacteria 4856
79 Ga0436365_1042342 3300039437 Bacteria 12868
80 Ga0436365_1161545 3300039437 Bacteria 623
81 Ga0436365_1498602 3300039437 Bacteria 1282
82 Ga0436365_1718243 3300039437 Bacteria 2970
83 Ga0436365_1872330 3300039437 Bacteria 1055
84 Ga0436365_1900245 3300039437 Bacteria 1348
85 Ga0436363_0967245 3300039450 Bacteria 1108
86 Ga0436363_1121158 3300039450 Bacteria 3920
87 Ga0436363_1162705 3300039450 Bacteria 8347
88 Ga0436362_0140833 3300039453 Bacteria 667
89 Ga0436362_0189145 3300039453 Bacteria 1470
90 Ga0439465_0268922 3300041413 Bacteria 633
91 Ga0451839_1488171 3300041496 Bacteria 941
92 Ga0451843_1660789 3300041509 Archaea 1019
93 Ga0466969_0056064 3300044656 Bacteria 1925
94 Ga0466965_0130920 3300044683 Bacteria 1301
95 Ga0466965_0216964 3300044683 Bacteria 1019
96 Ga0466966_0044035 3300044684 Bacteria 2859
97 Ga0466966_0056179 3300044684 Bacteria 2491
98 Ga0466966_0627496 3300044684 Bacteria 647
99 Ga0466966_0636871 3300044684 Bacteria 642
100 Ga0466961_0007678 3300044693 Bacteria 6867
101 Ga0466961_0225041 3300044693 Bacteria 1156
102 Ga0466961_0387299 3300044693 Unclassified 849
103 Ga0466961_0723918 3300044693 Bacteria 595
104 Ga0466963_0152690 3300044694 Bacteria 1604
105 Ga0466963_0179749 3300044694 Bacteria 1477
106 Ga0466963_0804424 3300044694 Bacteria 663
107 Ga0466963_1205281 3300044694 Bacteria 532
108 Ga0466971_0003263 3300044719 Bacteria 6923
109 Ga0466971_0087355 3300044719 Bacteria 1426
110 Ga0466971_0197049 3300044719 Bacteria 950
111 Ga0466971_0361966 3300044719 Bacteria 703
112 Ga0466970_0031915 3300044765 Bacteria 2783
113 Ga0466970_0168652 3300044765 Bacteria 1213
114 Ga0466970_0378026 3300044765 Bacteria 806
115 Ga0466957_0037979 3300044842 Bacteria 2900
116 Ga0466957_0198899 3300044842 Unclassified 1316
117 Ga0466959_0001970 3300045049 Bacteria 12928
118 Ga0466959_0064959 3300045049 Bacteria 2649
119 Ga0466959_0127920 3300045049 Bacteria 1802
120 Ga0466959_0228251 3300045049 Bacteria 1289
121 Ga0466959_0774598 3300045049 Bacteria 642
122 Ga0466958_0003376 3300045836 Bacteria 8279
123 Ga0466958_0004314 3300045836 Bacteria 7489
124 Ga0466958_0035602 3300045836 Bacteria 2974
125 Ga0466958_0084637 3300045836 Bacteria 1956
126 Ga0466958_0153620 3300045836 Bacteria 1452
127 Ga0466958_0396432 3300045836 Bacteria 891
128 Ga0466958_0543194 3300045836 Bacteria 755
129 Ga0466967_0013257 3300045976 Bacteria 6359
130 Ga0466967_0137779 3300045976 Unclassified 2271
131 Ga0466967_0346973 3300045976 Bacteria 1436
132 Ga0466967_0533981 3300045976 Bacteria 1153
133 Ga0466967_0882312 3300045976 Bacteria 889
134 Ga0466967_0981586 3300045976 Unclassified 841
135 Ga0495652_1115297 3300046529 Bacteria 512
136 Ga0495609_0205847 3300046538 Bacteria 821
137 Ga0495656_0321577 3300046615 Bacteria 797
138 Ga0495635_0941397 3300046663 Bacteria 552
139 Ga0495657_0455460 3300046675 Bacteria 749
140 Ga0501036_1274324 3300049572 Unclassified 598
141 Ga0501047_0413226 3300049581 Unclassified 1181
142 Ga0501076_1232254 3300049592 Bacteria 616
143 Ga0501044_0559185 3300049823 Unclassified 1040
144 nmdc:mga06z11_1015943_c1 3300050494 Unclassified 505
145 Ga0495601_0239364 3300053077 Bacteria 1185
146 Ga0495601_0976360 3300053077 Bacteria 533
147 Ga0501082_1236005 3300060353 Bacteria 653
148 Ga0466962_0027556 3300061719 Bacteria 2726
149 Ga0466962_0490599 3300061719 Bacteria 621
150 Ga0213874_10070385
151 Ga0068868_100884196
152 Ga0068868_101977169
153 Ga0070692_10790091
154 Ga0070674_100828238
155 Ga0070688_100134146
156 Ga0070678_100422635
157 Ga0070684_100161488
158 Ga0070664_100419336
159 Ga0070702_100916977
160 Ga0081540_1107267
161 Ga0070717_10842851
162 Ga0075432_10589490
163 Ga0075367_11088821
164 Ga0068865_100983515
165 Ga0105248_13141188
166 Ga0157375_12844647
167 Ga0157380_10937836
168 Ga0213873_10021949
169 Ga0213876_10025076
170 Ga0213876_10060983
171 Ga0213876_10236513
172 Ga0213875_10005359
173 Ga0213875_10047198
174 Ga0213875_10246533
175 Ga0207426_1060575
176 Ga0207688_10541727
177 Ga0207669_11283243
178 Ga0207704_10706675
179 Ga0207679_10937180
180 Ga0207677_10397009
181 Ga0307408_100113727
182 Ga0307408_100774326
183 Ga0307408_101709255
184 Ga0307405_10091692
185 Ga0307405_10234643
186 Ga0307405_10717972
187 Ga0307413_10024389
188 Ga0307413_10479839
189 Ga0307413_11138713
190 Ga0307410_10008387
191 Ga0307410_10708887
192 Ga0307406_10006639
193 Ga0307406_10087271
194 Ga0307406_11950355
195 Ga0307407_10034584
196 Ga0307407_10150261
197 Ga0307407_11332558
198 Ga0307412_10269886
199 Ga0307412_11751124
200 Ga0307409_100010616
201 Ga0307409_100022180
202 Ga0307409_100298376
203 Ga0307409_101042727
204 Ga0307416_100211340
205 Ga0307416_101204627
206 Ga0307416_102139341
207 Ga0307414_10130312
208 Ga0307414_10719964
209 Ga0307411_10155922
210 Ga0307415_100002014
211 Ga0307415_100026243
212 Ga0307415_100120496
213 Ga0307415_100699446
214 Ga0307415_101228321
215 Ga0307415_102042684
216 Ga0436364_0246061
217 Ga0436364_0509412
218 Ga0436364_0567381
219 Ga0436364_0576767
220 Ga0436364_1234933
221 Ga0436364_1287903
222 Ga0436364_1454144
223 Ga0436364_1473245
224 Ga0436365_0095352
225 Ga0436365_0364096
226 Ga0436365_0416351
227 Ga0436365_0806257
228 Ga0436365_1042342
229 Ga0436365_1161545
230 Ga0436365_1498602
231 Ga0436365_1718243
232 Ga0436365_1872330
233 Ga0436365_1900245
234 Ga0436363_0967245
235 Ga0436363_1121158
236 Ga0436363_1162705
237 Ga0436362_0140833
238 Ga0436362_0189145
239 Ga0439465_0268922
240 Ga0451839_1488171
241 Ga0451843_1660789
242 Ga0466969_0056064
243 Ga0466965_0130920
244 Ga0466965_0216964
245 Ga0466966_0044035
246 Ga0466966_0056179
247 Ga0466966_0627496
248 Ga0466966_0636871
249 Ga0466961_0007678
250 Ga0466961_0225041
251 Ga0466961_0387299
252 Ga0466961_0723918
253 Ga0466963_0152690
254 Ga0466963_0179749
255 Ga0466963_0804424
256 Ga0466963_1205281
257 Ga0466971_0003263
258 Ga0466971_0087355
259 Ga0466971_0197049
260 Ga0466971_0361966
261 Ga0466970_0031915
262 Ga0466970_0168652
263 Ga0466970_0378026
264 Ga0466957_0037979
265 Ga0466957_0198899
266 Ga0466959_0001970
267 Ga0466959_0064959
268 Ga0466959_0127920
269 Ga0466959_0228251
270 Ga0466959_0774598
271 Ga0466958_0003376
272 Ga0466958_0004314
273 Ga0466958_0035602
274 Ga0466958_0084637
275 Ga0466958_0153620
276 Ga0466958_0396432
277 Ga0466958_0543194
278 Ga0466967_0013257
279 Ga0466967_0137779
280 Ga0466967_0346973
281 Ga0466967_0533981
282 Ga0466967_0882312
283 Ga0466967_0981586
284 Ga0495652_1115297
285 Ga0495609_0205847
286 Ga0495656_0321577
287 Ga0495635_0941397
288 Ga0495657_0455460
289 Ga0501036_1274324
290 Ga0501047_0413226
291 Ga0501076_1232254
292 Ga0501044_0559185
293 nmdc:mga06z11_1015943_c1
294 Ga0495601_0239364
295 Ga0495601_0976360
296 Ga0501082_1236005
297 Ga0466962_0027556
298 Ga0466962_0490599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map