F205887

General Info

Members Datasets Scaffolds Average Seq Length
149 122 298 187

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10071279|Ga0105241_100712793
Length 216
Sequence VRPVLVRSRECSRTPFRLHVSIHTAEKGDKEKKVTNREQYTPGPASGAQVRKAGEKWTLILVRELRHSPEKVWQALTDPAQLREWAPFEVDESLATVGATVNLTWMGTGRLQATTVTRAEVPAVLEYGDIRWELEAFGVGTRLTLWHNIDRRFISWGAAGWHICFDVLDRLLSGTPIGRIAGPEAMEFGGWQRLNSEYARQFRIENPALPPSAPEH

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
90 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.04
Rhizosphere 87.25
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10071279 3300009174 Bacteria 2697
2 Ga0065712_10072894 3300005290 Bacteria 4572
3 Ga0065707_10087309 3300005295 Bacteria 5080
4 Ga0065707_10119369 3300005295 Bacteria 2161
5 Ga0070658_10007887 3300005327 Bacteria 8576
6 Ga0070683_100000168 3300005329 Bacteria 42900
7 Ga0070670_100106442 3300005331 Bacteria 2417
8 Ga0070666_10216748 3300005335 Bacteria 1349
9 Ga0070689_100605136 3300005340 Bacteria 950
10 Ga0070661_100009076 3300005344 Bacteria 6878
11 Ga0070661_100126292 3300005344 Bacteria 1919
12 Ga0070675_100085054 3300005354 Bacteria 2642
13 Ga0070671_100217394 3300005355 Bacteria 1621
14 Ga0070709_10001525 3300005434 Bacteria 12497
15 Ga0070713_100005906 3300005436 Bacteria 8416
16 Ga0070708_100295829 3300005445 Bacteria 1524
17 Ga0070663_100023656 3300005455 Bacteria 4121
18 Ga0070662_100262315 3300005457 Bacteria 1392
19 Ga0070681_10310661 3300005458 Bacteria 1486
20 Ga0068867_100142798 3300005459 Bacteria 1873
21 Ga0070672_100045247 3300005543 Bacteria 3403
22 Ga0070696_100014900 3300005546 Bacteria 5220
23 Ga0070665_100572687 3300005548 Unclassified 1142
24 Ga0070704_100324739 3300005549 Bacteria 1291
25 Ga0070664_100001765 3300005564 Bacteria 17336
26 Ga0070664_100321053 3300005564 Bacteria 1403
27 Ga0068856_100130954 3300005614 Bacteria 2513
28 Ga0068864_100029603 3300005618 Bacteria 4639
29 Ga0068863_100073815 3300005841 Bacteria 3227
30 Ga0068860_100069687 3300005843 Bacteria 3343
31 Ga0068862_100113075 3300005844 Bacteria 2385
32 Ga0070716_100008494 3300006173 Bacteria 5096
33 Ga0068871_100678408 3300006358 Bacteria 943
34 Ga0075428_100190126 3300006844 Bacteria 2220
35 Ga0075431_100191323 3300006847 Bacteria 2096
36 Ga0075431_100216945 3300006847 Bacteria 1952
37 Ga0075431_100712556 3300006847 Bacteria 981
38 Ga0075433_10211833 3300006852 Bacteria 1722
39 Ga0075433_10758493 3300006852 Bacteria 849
40 Ga0075434_100172841 3300006871 Bacteria 2180
41 Ga0075434_100384295 3300006871 Bacteria 1425
42 Ga0075429_100171747 3300006880 Bacteria 1899
43 Ga0099794_10243286 3300007265 Bacteria 927
44 Ga0099794_10291772 3300007265 Bacteria 844
45 Ga0105240_10110566 3300009093 Bacteria 3326
46 Ga0111539_10208245 3300009094 Bacteria 2279
47 Ga0114129_10210736 3300009147 Bacteria 2627
48 Ga0114129_10237904 3300009147 Bacteria 2449
49 Ga0114129_10594843 3300009147 Bacteria 1434
50 Ga0105241_10498983 3300009174 Bacteria 1085
51 Ga0105237_10150074 3300009545 Bacteria 2327
52 Ga0105238_10811933 3300009551 Unclassified 951
53 Ga0105249_10334762 3300009553 Bacteria 1529
54 Ga0105246_10109140 3300011119 Bacteria 2029
55 Ga0157369_10016049 3300013105 Bacteria 8427
56 Ga0157369_10383821 3300013105 Bacteria 1458
57 Ga0157374_10116594 3300013296 Bacteria 2573
58 Ga0157378_11505268 3300013297 Bacteria 718
59 Ga0163162_10227394 3300013306 Bacteria 1996
60 Ga0157375_10474399 3300013308 Bacteria 1416
61 Ga0157376_10005302 3300014969 Bacteria 9002
62 Ga0157376_10159909 3300014969 Bacteria 2041
63 Ga0213874_10010105 3300021377 Bacteria 2355
64 Ga0213874_10050336 3300021377 Bacteria 1276
65 Ga0213876_10047344 3300021384 Bacteria 2273
66 Ga0213876_10173162 3300021384 Bacteria 1148
67 Ga0207697_10021759 3300025315 Bacteria 2627
68 Ga0207647_10018204 3300025904 Bacteria 4760
69 Ga0207699_10001138 3300025906 Bacteria 12588
70 Ga0207707_10260239 3300025912 Bacteria 1506
71 Ga0207663_10180549 3300025916 Bacteria 1507
72 Ga0207663_10303320 3300025916 Bacteria 1194
73 Ga0207650_10080884 3300025925 Bacteria 2464
74 Ga0207659_10020671 3300025926 Bacteria 4355
75 Ga0207700_10126743 3300025928 Bacteria 2078
76 Ga0207690_10186481 3300025932 Bacteria 1566
77 Ga0207706_10031330 3300025933 Bacteria 4738
78 Ga0207670_10173681 3300025936 Bacteria 1618
79 Ga0207691_10059383 3300025940 Bacteria 3477
80 Ga0207661_10301366 3300025944 Bacteria 1437
81 Ga0207667_10017468 3300025949 Bacteria 8071
82 Ga0207677_10914439 3300026023 Bacteria 792
83 Ga0207639_10343404 3300026041 Bacteria 1331
84 Ga0207639_10997992 3300026041 Bacteria 784
85 Ga0207702_10901061 3300026078 Bacteria 876
86 Ga0207648_10139869 3300026089 Bacteria 2133
87 Ga0207676_10148938 3300026095 Bacteria 2013
88 Ga0207675_100556654 3300026118 Bacteria 1146
89 Ga0207683_10217589 3300026121 Bacteria 1740
90 Ga0207698_10105874 3300026142 Bacteria 2344
91 Ga0268264_10153440 3300028381 Bacteria 2067
92 Ga0268264_10618188 3300028381 Bacteria 1069
93 Ga0265324_10000667 3300029957 Bacteria 23156
94 Ga0265760_10059356 3300031090 Bacteria 1161
95 Ga0265331_10200195 3300031250 Bacteria 900
96 Ga0265316_10041539 3300031344 Bacteria 3680
97 Ga0373936_0086331 3300035113 Bacteria 1311
98 Ga0373945_0049337 3300035116 Bacteria 1544
99 Ga0373957_0055708 3300035120 Bacteria 1521
100 Ga0373943_0017655 3300035170 Bacteria 3266
101 Ga0373935_0039554 3300035692 Bacteria 2957
102 Ga0373927_0003956 3300035695 Bacteria 10490
103 Ga0373925_0000179 3300037068 Bacteria 69286
104 Ga0436365_0987505 3300039437 Bacteria 2794
105 Ga0436365_1044904 3300039437 Bacteria 2313
106 Ga0436365_1817103 3300039437 Bacteria 1430
107 Ga0436363_0229993 3300039450 Bacteria 2328
108 Ga0436363_1128194 3300039450 Bacteria 4384
109 Ga0436362_0096096 3300039453 Bacteria 2229
110 Ga0451791_0498399 3300041451 Bacteria 1465
111 Ga0451793_1905347 3300041452 Bacteria 4009
112 Ga0451807_1232657 3300041486 Bacteria 1684
113 Ga0451853_4084484 3300041512 Bacteria 1005
114 Ga0466958_0019340 3300045836 Bacteria 3965
115 Ga0466967_0077797 3300045976 Bacteria 2987
116 Ga0466967_0667442 3300045976 Bacteria 1029
117 Ga0495603_0119683 3300046455 Bacteria 1535
118 Ga0495641_0171044 3300046461 Bacteria 972
119 Ga0495580_0014467 3300046472 Bacteria 5985
120 Ga0495580_0079850 3300046472 Bacteria 2281
121 Ga0495582_0313190 3300046473 Bacteria 903
122 Ga0495665_0071370 3300046531 Bacteria 1829
123 Ga0495665_0127444 3300046531 Bacteria 1333
124 Ga0495586_0128177 3300046535 Bacteria 1420
125 Ga0495667_0372603 3300046559 Bacteria 901
126 Ga0495634_0225215 3300046642 Unclassified 1156
127 Ga0495588_0009849 3300046674 Bacteria 4431
128 Ga0495676_0024971 3300047321 Bacteria 5164
129 Ga0495615_0077129 3300048090 Bacteria 908
130 Ga0496101_0954551 3300048904 Bacteria 675
131 Ga0496105_0242212 3300048908 Bacteria 1463
132 Ga0496108_0002637 3300048911 Bacteria 14374
133 Ga0496112_0389237 3300048915 Bacteria 1334
134 Ga0496113_0034064 3300048916 Bacteria 3713
135 Ga0496114_0285427 3300048917 Bacteria 1456
136 Ga0501046_0380452 3300049580 Bacteria 1022
137 Ga0501076_0281821 3300049592 Bacteria 1362
138 Ga0501081_0522213 3300049743 Bacteria 886
139 Ga0501044_0458849 3300049823 Bacteria 1180
140 nmdc:mga05p37_439309_c1 3300050507 Bacteria 1514
141 nmdc:mga09592_112479_c1 3300050508 Bacteria 2336
142 nmdc:mga06r32_1025470_c1 3300050510 Bacteria 777
143 nmdc:mga06r32_240521_c1 3300050510 Bacteria 1798
144 nmdc:mga06r32_27800_c1 3300050510 Bacteria 5288
145 nmdc:mga0n895_133436_c1 3300050512 Bacteria 2509
146 nmdc:mga0rr50_537005_c1 3300050513 Bacteria 995
147 nmdc:mga0rr50_985701_c1 3300050513 Bacteria 718
148 Ga0501084_0120881 3300054114 Bacteria 2202
149 Ga0530510_0496088 3300061734 Bacteria 925
150 Ga0105241_10071279
151 Ga0065712_10072894
152 Ga0065707_10087309
153 Ga0065707_10119369
154 Ga0070658_10007887
155 Ga0070683_100000168
156 Ga0070670_100106442
157 Ga0070666_10216748
158 Ga0070689_100605136
159 Ga0070661_100009076
160 Ga0070661_100126292
161 Ga0070675_100085054
162 Ga0070671_100217394
163 Ga0070709_10001525
164 Ga0070713_100005906
165 Ga0070708_100295829
166 Ga0070663_100023656
167 Ga0070662_100262315
168 Ga0070681_10310661
169 Ga0068867_100142798
170 Ga0070672_100045247
171 Ga0070696_100014900
172 Ga0070665_100572687
173 Ga0070704_100324739
174 Ga0070664_100001765
175 Ga0070664_100321053
176 Ga0068856_100130954
177 Ga0068864_100029603
178 Ga0068863_100073815
179 Ga0068860_100069687
180 Ga0068862_100113075
181 Ga0070716_100008494
182 Ga0068871_100678408
183 Ga0075428_100190126
184 Ga0075431_100191323
185 Ga0075431_100216945
186 Ga0075431_100712556
187 Ga0075433_10211833
188 Ga0075433_10758493
189 Ga0075434_100172841
190 Ga0075434_100384295
191 Ga0075429_100171747
192 Ga0099794_10243286
193 Ga0099794_10291772
194 Ga0105240_10110566
195 Ga0111539_10208245
196 Ga0114129_10210736
197 Ga0114129_10237904
198 Ga0114129_10594843
199 Ga0105241_10498983
200 Ga0105237_10150074
201 Ga0105238_10811933
202 Ga0105249_10334762
203 Ga0105246_10109140
204 Ga0157369_10016049
205 Ga0157369_10383821
206 Ga0157374_10116594
207 Ga0157378_11505268
208 Ga0163162_10227394
209 Ga0157375_10474399
210 Ga0157376_10005302
211 Ga0157376_10159909
212 Ga0213874_10010105
213 Ga0213874_10050336
214 Ga0213876_10047344
215 Ga0213876_10173162
216 Ga0207697_10021759
217 Ga0207647_10018204
218 Ga0207699_10001138
219 Ga0207707_10260239
220 Ga0207663_10180549
221 Ga0207663_10303320
222 Ga0207650_10080884
223 Ga0207659_10020671
224 Ga0207700_10126743
225 Ga0207690_10186481
226 Ga0207706_10031330
227 Ga0207670_10173681
228 Ga0207691_10059383
229 Ga0207661_10301366
230 Ga0207667_10017468
231 Ga0207677_10914439
232 Ga0207639_10343404
233 Ga0207639_10997992
234 Ga0207702_10901061
235 Ga0207648_10139869
236 Ga0207676_10148938
237 Ga0207675_100556654
238 Ga0207683_10217589
239 Ga0207698_10105874
240 Ga0268264_10153440
241 Ga0268264_10618188
242 Ga0265324_10000667
243 Ga0265760_10059356
244 Ga0265331_10200195
245 Ga0265316_10041539
246 Ga0373936_0086331
247 Ga0373945_0049337
248 Ga0373957_0055708
249 Ga0373943_0017655
250 Ga0373935_0039554
251 Ga0373927_0003956
252 Ga0373925_0000179
253 Ga0436365_0987505
254 Ga0436365_1044904
255 Ga0436365_1817103
256 Ga0436363_0229993
257 Ga0436363_1128194
258 Ga0436362_0096096
259 Ga0451791_0498399
260 Ga0451793_1905347
261 Ga0451807_1232657
262 Ga0451853_4084484
263 Ga0466958_0019340
264 Ga0466967_0077797
265 Ga0466967_0667442
266 Ga0495603_0119683
267 Ga0495641_0171044
268 Ga0495580_0014467
269 Ga0495580_0079850
270 Ga0495582_0313190
271 Ga0495665_0071370
272 Ga0495665_0127444
273 Ga0495586_0128177
274 Ga0495667_0372603
275 Ga0495634_0225215
276 Ga0495588_0009849
277 Ga0495676_0024971
278 Ga0495615_0077129
279 Ga0496101_0954551
280 Ga0496105_0242212
281 Ga0496108_0002637
282 Ga0496112_0389237
283 Ga0496113_0034064
284 Ga0496114_0285427
285 Ga0501046_0380452
286 Ga0501076_0281821
287 Ga0501081_0522213
288 Ga0501044_0458849
289 nmdc:mga05p37_439309_c1
290 nmdc:mga09592_112479_c1
291 nmdc:mga06r32_1025470_c1
292 nmdc:mga06r32_240521_c1
293 nmdc:mga06r32_27800_c1
294 nmdc:mga0n895_133436_c1
295 nmdc:mga0rr50_537005_c1
296 nmdc:mga0rr50_985701_c1
297 Ga0501084_0120881
298 Ga0530510_0496088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

66

173

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8566 25 146
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8395 25 154
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8231 25 154
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8222 25 150
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8138 25 145
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8138 25 145 3.30.530.20
af_A0A1D6HQJ5_8_161_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8118 21 139 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7983 25 144 3.30.530.20
af_P9WL87_17_165_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7981 25 147 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7931 27 146 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.9875 3 177
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.9764 3 177
AF-A0A2N7VIV1-F1-model_v4 Polyketide cyclase 0.9717 1 177
AF-A0A2V9UXS0-F1-model_v4 Polyketide cyclase 0.9664 4 185
AF-A0A2N7VIV1-F1-model_v4 Polyketide cyclase 0.9662 1 177

Map