F205633

General Info

Members Datasets Scaffolds Average Seq Length
149 108 138 336

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10010065|Ga0075364_100100652
Length 354
Sequence MPISTTRKRRGLAAAVAVVLAAGTLAGCRSGSSDAATGDDASGRPKVTIMVGGIDKVIYLPAMLTQQLGYFDDEGVDVKLMTEPSGSSAENVLVAGQVQGVVGFYDHTITLQAQGKCIESVVQLAKVPGEAEVVSNAAAGSLTGPADFEGGKLGVTSPGSSTDYLTQYLATKSGVDTSSYTTVTAGAGSTFLAALSNGGIDAGMTTDPTIATVVSKGLGKVLIDMRTEEGTRAALGGLYPAASMYMDCSYVDDNPETVQKLVTAFTRTLGWISTHTPEQIAAEMPTDYNGGDPQLYAESIKDSSPMFTTDGRMPEGGPETVLDVLGTFSDVVKAQRDDIDLSKTYTTEFVDSVS

Samples

Sample ID Description Type Environment
1 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
2 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
3 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
4 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
5 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
6 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
7 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
8 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
58 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
59 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
60 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
61 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
62 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
81 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
100 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
101 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
102 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
103 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
104 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
105 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
106 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
107 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
108 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.95
Metatranscriptomes 0.67
Isolates 7.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.38
Nodule 0
Rhizoplane 4.03
Rhizosphere 74.5
Stem 0
Stem Tuber 0.67
Unclassified 13.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10027747 3300005327 Bacteria 4543
2 Ga0070658_10119981 3300005327 Bacteria 2185
3 Ga0070667_100061798 3300005367 Bacteria 3172
4 Ga0070667_100067885 3300005367 Bacteria 3033
5 Ga0070663_100000860 3300005455 Bacteria 16468
6 Ga0070663_100025873 3300005455 Bacteria 3967
7 Ga0070679_100339682 3300005530 Bacteria 1450
8 Ga0070693_100214670 3300005547 Bacteria 1257
9 Ga0070665_100229786 3300005548 Bacteria 1855
10 Ga0070665_100409878 3300005548 Bacteria 1363
11 Ga0068855_100270427 3300005563 Bacteria 1890
12 Ga0070702_100005869 3300005615 Bacteria 5761
13 Ga0068866_10114817 3300005718 Bacteria 1508
14 Ga0068863_100017684 3300005841 Bacteria 6825
15 Ga0081539_10000547 3300005985 Bacteria 77531
16 Ga0081539_10025053 3300005985 Bacteria 3854
17 Ga0075363_100027713 3300006048 Bacteria 2907
18 Ga0075364_10010065 3300006051 Bacteria 5699
19 Ga0075370_10253565 3300006353 Bacteria 1043
20 Ga0105245_10110991 3300009098 Bacteria 2550
21 Ga0105247_10092788 3300009101 Bacteria 1918
22 Ga0105243_10098265 3300009148 Bacteria 2424
23 Ga0105242_10219625 3300009176 Bacteria 1698
24 Ga0105248_10165210 3300009177 Bacteria 2496
25 Ga0105237_10247164 3300009545 Bacteria 1786
26 Ga0105238_10322422 3300009551 Bacteria 1531
27 Ga0105249_10195331 3300009553 Bacteria 1977
28 Ga0105239_10018054 3300010375 Bacteria 7803
29 Ga0105239_10264873 3300010375 Bacteria 1932
30 Ga0157317_1000248 3300012475 Bacteria 2010
31 Ga0157378_10048451 3300013297 Bacteria 3778
32 Ga0157378_10077354 3300013297 Bacteria 2999
33 Ga0157375_10020269 3300013308 Bacteria 6070
34 Ga0157380_10045653 3300014326 Bacteria 3439
35 Ga0206353_10231760 3300020082 Bacteria 1367
36 Ga0207647_10036490 3300025904 Bacteria 3123
37 Ga0207657_10155464 3300025919 Bacteria 1860
38 Ga0207652_10231888 3300025921 Bacteria 1664
39 Ga0207706_10073671 3300025933 Bacteria 3003
40 Ga0207686_10231730 3300025934 Bacteria 1339
41 Ga0207679_10067363 3300025945 Bacteria 2686
42 Ga0207667_10351813 3300025949 Bacteria 1502
43 Ga0207668_10002594 3300025972 Bacteria 10567
44 Ga0207658_10100022 3300025986 Bacteria 2269
45 Ga0207658_10102994 3300025986 Bacteria 2240
46 Ga0207678_10000033 3300026067 Bacteria 105464
47 Ga0207678_10036422 3300026067 Bacteria 4283
48 Ga0207641_10179072 3300026088 Bacteria 1940
49 Ga0209813_10016832 3300027866 Bacteria 2000
50 Ga0268266_10156470 3300028379 Bacteria 2059
51 Ga0268266_10237735 3300028379 Bacteria 1680
52 Ga0307515_10020972 3300028794 Bacteria 11613
53 Ga0307515_10031664 3300028794 Bacteria 8802
54 Ga0307515_10074519 3300028794 Bacteria 4538
55 Ga0307512_10015793 3300030522 Bacteria 6989
56 Ga0307512_10133212 3300030522 Bacteria 1550
57 Ga0265327_10005168 3300031251 Bacteria 11058
58 Ga0265316_10069998 3300031344 Bacteria 2707
59 Ga0307513_10007992 3300031456 Bacteria 13590
60 Ga0307508_10041707 3300031616 Bacteria 4118
61 Ga0307508_10048116 3300031616 Bacteria 3800
62 Ga0307516_10040932 3300031730 Bacteria 4608
63 Ga0307518_10075879 3300031838 Bacteria 2431
64 Ga0307507_10043657 3300033179 Bacteria 4445
65 Ga0307507_10095837 3300033179 Bacteria 2513
66 Ga0307510_10038876 3300033180 Bacteria 5252
67 Ga0373938_0032331 3300034957 Bacteria 1126
68 Ga0373940_0007912 3300035088 Bacteria 2418
69 Ga0373942_0000253 3300035207 Bacteria 14252
70 Ga0395899_0062191 3300037312 Bacteria 2749
71 Ga0395900_0016265 3300037418 Bacteria 7581
72 Ga0395900_0511992 3300037418 Unclassified 1149
73 Ga0395898_0012981 3300037466 Bacteria 8590
74 Ga0395898_0130460 3300037466 Bacteria 2408
75 Ga0395901_0021183 3300038443 Bacteria 6658
76 Ga0395901_0025356 3300038443 Bacteria 6087
77 Ga0395901_0054354 3300038443 Bacteria 4162
78 Ga0395901_0058115 3300038443 Bacteria 4023
79 Ga0451853_2508013 3300041512 Bacteria 1686
80 Ga0466972_0008281 3300044658 Bacteria 5210
81 Ga0466972_0119360 3300044658 Bacteria 1244
82 Ga0466965_0036752 3300044683 Bacteria 2403
83 Ga0466961_0196093 3300044693 Bacteria 1250
84 Ga0466961_0200769 3300044693 Bacteria 1233
85 Ga0466963_0066862 3300044694 Bacteria 2411
86 Ga0466963_0189161 3300044694 Bacteria 1438
87 Ga0466963_0251395 3300044694 Bacteria 1240
88 Ga0466964_0041059 3300044706 Bacteria 1870
89 Ga0466970_0020927 3300044765 Bacteria 3404
90 Ga0466970_0154332 3300044765 Bacteria 1268
91 Ga0466970_0169572 3300044765 Bacteria 1209
92 Ga0466957_0394589 3300044842 Bacteria 945
93 Ga0466960_0003381 3300044901 Bacteria 6126
94 Ga0466960_0006203 3300044901 Bacteria 4787
95 Ga0466960_0024345 3300044901 Bacteria 2730
96 Ga0466960_0044969 3300044901 Bacteria 2107
97 Ga0466960_0267036 3300044901 Bacteria 955
98 Ga0466959_0336969 3300045049 Bacteria 1029
99 Ga0466958_0156525 3300045836 Bacteria 1438
100 Ga0466967_0006452 3300045976 Bacteria 8302
101 Ga0466967_0037057 3300045976 Bacteria 4169
102 Ga0466967_0053405 3300045976 Bacteria 3551
103 Ga0466967_0054599 3300045976 Bacteria 3517
104 Ga0466967_0123337 3300045976 Bacteria 2397
105 Ga0466967_0182605 3300045976 Bacteria 1979
106 Ga0466967_0736854 3300045976 Bacteria 977
107 Ga0495603_0018761 3300046455 Bacteria 4186
108 Ga0495632_0139104 3300046519 Bacteria 1127
109 Ga0495633_0001571 3300046558 Bacteria 17492
110 Ga0496101_0064267 3300048904 Bacteria 2673
111 Ga0496102_0126439 3300048905 Bacteria 2390
112 Ga0496104_0301928 3300048907 Bacteria 1513
113 Ga0496105_0020756 3300048908 Bacteria 5310
114 Ga0496108_0000294 3300048911 Bacteria 42903
115 Ga0496115_0152140 3300048918 Bacteria 1911
116 Ga0501032_0221719 3300049569 Bacteria 1231
117 Ga0501036_0002136 3300049572 Bacteria 15421
118 Ga0501038_0014109 3300049574 Bacteria 7278
119 Ga0501038_0041255 3300049574 Bacteria 4025
120 Ga0501039_0038620 3300049575 Bacteria 3687
121 Ga0501043_0011269 3300049579 Bacteria 6999
122 Ga0501043_0129571 3300049579 Bacteria 1977
123 Ga0501047_0014717 3300049581 Bacteria 7444
124 Ga0501048_0009338 3300049582 Bacteria 7364
125 Ga0501073_0054871 3300049589 Bacteria 2789
126 Ga0501074_0004598 3300049590 Bacteria 9885
127 Ga0501074_0066472 3300049590 Bacteria 2594
128 Ga0501035_0082337 3300049822 Bacteria 2840
129 Ga0501044_0012690 3300049823 Bacteria 9125
130 Ga0501044_0059152 3300049823 Bacteria 3927
131 Ga0501044_0263749 3300049823 Bacteria 1660
132 nmdc:mga03n38_33147_c1 3300050490 Bacteria 2195
133 nmdc:mga06z11_41181_c1 3300050494 Bacteria 2311
134 nmdc:mga04h51_5589_c1 3300050495 Bacteria 3211
135 Ga0500644_0006497 3300053088 Bacteria 3001
136 Ga0500660_097286 3300053100 Bacteria 1295
137 Ga0500600_0080926 3300053149 Bacteria 1757
138 Ga0500616_0007033 3300053153 Bacteria 7224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0267036 Ga0466960_0267036_11_772 251
2 3300045049 Ga0466959_0336969 Ga0466959_0336969_73_990 279
3 3300045976 Ga0466967_0736854 Ga0466967_0736854_41_958 279
4 3300044765 Ga0466970_0169572 Ga0466970_0169572_116_1162 286
5 3300045836 Ga0466958_0156525 Ga0466958_0156525_345_1391 286
6 3300053100 Ga0500660_097286 Ga0500660_097286_396_1271 290
7 3300046519 Ga0495632_0139104 Ga0495632_0139104_181_1104 296
8 3300006353 Ga0075370_10253565 Ga0075370_102535651 298
9 3300048907 Ga0496104_0301928 Ga0496104_0301928_536_1450 304
10 3300044842 Ga0466957_0394589 Ga0466957_0394589_14_934 306
11 3300046558 Ga0495633_0001571 Ga0495633_0001571_4716_5738 312
12 3300044694 Ga0466963_0189161 Ga0466963_0189161_362_1408 314
13 3300045976 Ga0466967_0053405 Ga0466967_0053405_1494_2537 315
14 3300037312 Ga0395899_0062191 Ga0395899_0062191_1555_2592 316
15 3300037418 Ga0395900_0016265 Ga0395900_0016265_1354_2391 316
16 3300037466 Ga0395898_0130460 Ga0395898_0130460_233_1270 316
17 3300038443 Ga0395901_0058115 Ga0395901_0058115_2236_3273 316
18 3300044694 Ga0466963_0066862 Ga0466963_0066862_1260_2303 316
19 3300045976 Ga0466967_0037057 Ga0466967_0037057_3099_4139 316
20 3300012475 Ga0157317_1000248 Ga0157317_10002481 319
21 3300033179 Ga0307507_10095837 Ga0307507_100958372 319
22 3300045976 Ga0466967_0006452 Ga0466967_0006452_6903_7934 319
23 3300009545 Ga0105237_10247164 Ga0105237_102471642 323
24 3300010375 Ga0105239_10018054 Ga0105239_100180542 323
25 3300028794 Ga0307515_10020972 Ga0307515_100209722 323
26 3300028794 Ga0307515_10031664 Ga0307515_100316645 323
27 3300030522 Ga0307512_10015793 Ga0307512_100157932 323
28 3300031456 Ga0307513_10007992 Ga0307513_100079928 323
29 3300031616 Ga0307508_10041707 Ga0307508_100417074 323
30 3300053088 Ga0500644_0006497 Ga0500644_0006497_1416_2447 323
31 3300031838 Ga0307518_10075879 Ga0307518_100758791 324
32 3300045976 Ga0466967_0054599 Ga0466967_0054599_1132_2187 325
33 iso_pu_bacteria 2895880812 2895884480 327
34 3300006048 Ga0075363_100027713 Ga0075363_1000277132 328
35 3300027866 Ga0209813_10016832 Ga0209813_100168322 328
36 3300044693 Ga0466961_0200769 Ga0466961_0200769_145_1188 328
37 3300044694 Ga0466963_0251395 Ga0466963_0251395_52_1095 328
38 3300044706 Ga0466964_0041059 Ga0466964_0041059_767_1810 328
39 3300044901 Ga0466960_0024345 Ga0466960_0024345_778_1821 328
40 3300045976 Ga0466967_0182605 Ga0466967_0182605_515_1558 328
41 3300050490 nmdc:mga03n38_33147_c1 nmdc:mga03n38_33147_c1_809_1873 328
42 3300050494 nmdc:mga06z11_41181_c1 nmdc:mga06z11_41181_c1_1057_2121 328
43 3300050495 nmdc:mga04h51_5589_c1 nmdc:mga04h51_5589_c1_1325_2389 328
44 3300049572 Ga0501036_0002136 Ga0501036_0002136_4345_5391 329
45 3300049574 Ga0501038_0014109 Ga0501038_0014109_1510_2556 329
46 3300049579 Ga0501043_0011269 Ga0501043_0011269_4459_5505 329
47 3300049581 Ga0501047_0014717 Ga0501047_0014717_4912_5958 329
48 3300049582 Ga0501048_0009338 Ga0501048_0009338_1989_3035 329
49 3300049589 Ga0501073_0054871 Ga0501073_0054871_1730_2776 329
50 3300049590 Ga0501074_0004598 Ga0501074_0004598_8396_9442 329
51 3300049823 Ga0501044_0263749 Ga0501044_0263749_155_1201 329
52 3300037418 Ga0395900_0511992 Ga0395900_0511992_70_1083 330
53 3300038443 Ga0395901_0054354 Ga0395901_0054354_3077_4090 330
54 3300009553 Ga0105249_10195331 Ga0105249_101953311 331
55 3300014326 Ga0157380_10045653 Ga0157380_100456531 331
56 3300037466 Ga0395898_0012981 Ga0395898_0012981_254_1285 334
57 3300038443 Ga0395901_0021183 Ga0395901_0021183_5602_6633 334
58 3300053153 Ga0500616_0007033 Ga0500616_0007033_5158_6195 334
59 iso_pu_bacteria 2932422444 2932425109 334
60 3300005367 Ga0070667_100061798 Ga0070667_1000617982 335
61 3300025986 Ga0207658_10102994 Ga0207658_101029943 335
62 3300049575 Ga0501039_0038620 Ga0501039_0038620_2662_3675 336
63 3300049579 Ga0501043_0129571 Ga0501043_0129571_470_1483 336
64 3300049590 Ga0501074_0066472 Ga0501074_0066472_232_1245 336
65 3300049822 Ga0501035_0082337 Ga0501035_0082337_39_1052 336
66 3300049823 Ga0501044_0059152 Ga0501044_0059152_1528_2541 336
67 iso_pu_bacteria 2751185782 2753270723 336
68 iso_pu_bacteria 2684623035 2686535248 337
69 3300028379 Ga0268266_10156470 Ga0268266_101564702 338
70 3300048911 Ga0496108_0000294 Ga0496108_0000294_10923_11945 338
71 3300010375 Ga0105239_10264873 Ga0105239_102648732 339
72 3300044658 Ga0466972_0119360 Ga0466972_0119360_144_1187 339
73 3300049569 Ga0501032_0221719 Ga0501032_0221719_51_1073 339
74 3300049574 Ga0501038_0041255 Ga0501038_0041255_1110_2132 339
75 3300005367 Ga0070667_100067885 Ga0070667_1000678854 340
76 3300005548 Ga0070665_100409878 Ga0070665_1004098782 340
77 3300013297 Ga0157378_10077354 Ga0157378_100773543 340
78 3300025921 Ga0207652_10231888 Ga0207652_102318881 340
79 3300025986 Ga0207658_10100022 Ga0207658_101000221 340
80 3300031616 Ga0307508_10048116 Ga0307508_100481164 340
81 3300031730 Ga0307516_10040932 Ga0307516_100409322 340
82 3300034957 Ga0373938_0032331 Ga0373938_0032331_35_1066 340
83 3300035088 Ga0373940_0007912 Ga0373940_0007912_538_1569 340
84 3300035207 Ga0373942_0000253 Ga0373942_0000253_12168_13199 340
85 3300038443 Ga0395901_0025356 Ga0395901_0025356_126_1160 340
86 3300041512 Ga0451853_2508013 Ga0451853_2508013_509_1540 340
87 3300044901 Ga0466960_0006203 Ga0466960_0006203_2233_3258 340
88 3300053149 Ga0500600_0080926 Ga0500600_0080926_712_1746 340
89 3300005841 Ga0068863_100017684 Ga0068863_1000176841 341
90 3300009101 Ga0105247_10092788 Ga0105247_100927882 341
91 3300009177 Ga0105248_10165210 Ga0105248_101652101 341
92 3300009551 Ga0105238_10322422 Ga0105238_103224221 341
93 3300026088 Ga0207641_10179072 Ga0207641_101790721 341
94 3300028379 Ga0268266_10237735 Ga0268266_102377351 341
95 3300048908 Ga0496105_0020756 Ga0496105_0020756_167_1204 341
96 iso_pu_bacteria 2891395885 2891401763 341
97 iso_pu_bacteria 2899370129 2899370242 341
98 iso_pu_bacteria 2917736166 2917745124 341
99 iso_pu_bacteria 8003314358 8003314444 341
100 3300005327 Ga0070658_10119981 Ga0070658_101199812 342
101 3300005530 Ga0070679_100339682 Ga0070679_1003396822 342
102 3300005563 Ga0068855_100270427 Ga0068855_1002704271 342
103 3300020082 Ga0206353_10231760 Ga0206353_102317601 342
104 3300025949 Ga0207667_10351813 Ga0207667_103518131 342
105 3300031251 Ga0265327_10005168 Ga0265327_100051688 342
106 3300031344 Ga0265316_10069998 Ga0265316_100699983 342
107 iso_pu_bacteria 8055066027 8055066828 342
108 iso_pu_bacteria 8055172936 8055179720 342
109 3300005455 Ga0070663_100000860 Ga0070663_1000008607 344
110 3300005548 Ga0070665_100229786 Ga0070665_1002297861 344
111 3300005985 Ga0081539_10025053 Ga0081539_100250531 344
112 3300009176 Ga0105242_10219625 Ga0105242_102196252 344
113 3300025934 Ga0207686_10231730 Ga0207686_102317302 344
114 3300025972 Ga0207668_10002594 Ga0207668_100025943 344
115 3300026067 Ga0207678_10000033 Ga0207678_1000003318 344
116 3300028794 Ga0307515_10074519 Ga0307515_100745194 344
117 3300030522 Ga0307512_10133212 Ga0307512_101332122 344
118 3300033180 Ga0307510_10038876 Ga0307510_100388764 344
119 3300044658 Ga0466972_0008281 Ga0466972_0008281_880_1935 344
120 3300044683 Ga0466965_0036752 Ga0466965_0036752_44_1084 344
121 3300044693 Ga0466961_0196093 Ga0466961_0196093_169_1209 344
122 3300044765 Ga0466970_0154332 Ga0466970_0154332_154_1194 344
123 3300044901 Ga0466960_0044969 Ga0466960_0044969_961_2016 344
124 3300046455 Ga0495603_0018761 Ga0495603_0018761_2400_3464 344
125 3300049823 Ga0501044_0012690 Ga0501044_0012690_1411_2457 344
126 iso_pu_bacteria 2883821847 2883824817 344
127 3300005547 Ga0070693_100214670 Ga0070693_1002146701 345
128 3300005615 Ga0070702_100005869 Ga0070702_1000058696 345
129 3300005718 Ga0068866_10114817 Ga0068866_101148172 345
130 3300009148 Ga0105243_10098265 Ga0105243_100982652 345
131 3300013297 Ga0157378_10048451 Ga0157378_100484513 345
132 3300013308 Ga0157375_10020269 Ga0157375_100202693 345
133 3300044765 Ga0466970_0020927 Ga0466970_0020927_66_1106 345
134 3300045976 Ga0466967_0123337 Ga0466967_0123337_55_1095 345
135 3300005327 Ga0070658_10027747 Ga0070658_100277472 346
136 3300005455 Ga0070663_100025873 Ga0070663_1000258733 346
137 3300005985 Ga0081539_10000547 Ga0081539_1000054759 346
138 3300006051 Ga0075364_10010065 Ga0075364_100100652 346
139 3300009098 Ga0105245_10110991 Ga0105245_101109912 346
140 3300025904 Ga0207647_10036490 Ga0207647_100364903 346
141 3300025919 Ga0207657_10155464 Ga0207657_101554642 346
142 3300025933 Ga0207706_10073671 Ga0207706_100736711 346
143 3300025945 Ga0207679_10067363 Ga0207679_100673631 346
144 3300026067 Ga0207678_10036422 Ga0207678_100364223 346
145 3300033179 Ga0307507_10043657 Ga0307507_100436574 346
146 3300044901 Ga0466960_0003381 Ga0466960_0003381_4194_5240 346
147 3300048904 Ga0496101_0064267 Ga0496101_0064267_931_1977 346
148 3300048905 Ga0496102_0126439 Ga0496102_0126439_508_1569 346
149 3300048918 Ga0496115_0152140 Ga0496115_0152140_826_1872 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

58

280

0.86

PF13379

NMT1_2

NMT1-like family

42

285

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qsl-assembly1.cif.gz_A structure of cae31940 from bordetella bronchiseptica rb50 0.9134 38 345
3qsl-assembly1.cif.gz_A structure of cae31940 from bordetella bronchiseptica rb50 0.8784 38 345
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8262 38 339
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8114 38 346
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8084 38 339
ID Description Score Start End Superfamily
3qslA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9564 38 345 3.40.190.10
3qslB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9183 122 229 3.40.190.10
3qslA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8973 38 345 3.40.190.10
3qslB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8946 122 229 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.889 119 217 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7C2IDF8-F1-model_v4 ABC transporter substrate-binding protein 0.9656 214 345
AF-A0A530LIQ9-F1-model_v4 ABC transporter substrate-binding protein 0.9596 200 346
AF-A0A531MEK8-F1-model_v4 ABC transporter substrate-binding protein 0.9442 142 346 GO:0042918
AF-A0A7X6L5V8-F1-model_v4 ABC transporter substrate-binding protein 0.9417 20 345 GO:0042918
AF-A0A352Y287-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9402 82 346 GO:0042918

Feature Viewer

pLDDT pTM Quality
89.68 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map