F205548

General Info

Members Datasets Scaffolds Average Seq Length
149 108 149 325

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100004836|Ga0068858_10000483613
Length 359
Sequence MASAGGTADNAIHTGARGVRRRWIPGGKGITVGLAFLLAAVLLYYSLRGIEWREVARIVAAAKLRYLGLAVVVSTGTLLLRALRWRILLNAHGAVDLPTVFWATAAGYFGNSFLPARAGELVRTVLVSSRSTLDNAYVLATALSERVADAVALVAITALVLLTLPVRPGWLASAAMPFAIVALLGVSLIAVLPWLESSVRTLLERAPLPQAVRPTLMTAMEQGLRGIRAFHDPKRLLGFVALTIVIWTLDALGTVIGGAALGLSIPISVAFLLIASLGLGSALPSTPGYVGIYQFVAVTVLTPFGFSRADAIAYILVAQALXXXLVGFWGSLGLWRYRRSGLSVAAEAMPFPSEVNRSK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
81 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.71
Nodule 0
Rhizoplane 0
Rhizosphere 84.56
Stem 0
Stem Tuber 0
Unclassified 8.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100003767 3300005329 Bacteria 12378
2 Ga0070683_100233713 3300005329 Bacteria 1748
3 Ga0068869_100032262 3300005334 Bacteria 3690
4 Ga0070673_100010356 3300005364 Bacteria 6309
5 Ga0070673_100039476 3300005364 Unclassified 3613
6 Ga0070713_100077488 3300005436 Bacteria 2826
7 Ga0070681_10144978 3300005458 Bacteria 2304
8 Ga0070707_100108391 3300005468 Unclassified 2694
9 Ga0070684_100008990 3300005535 Bacteria 7848
10 Ga0068853_100238040 3300005539 Unclassified 1668
11 Ga0070695_100087815 3300005545 Bacteria 2069
12 Ga0070665_100060203 3300005548 Unclassified 3806
13 Ga0068855_100000992 3300005563 Bacteria 35309
14 Ga0068855_100082139 3300005563 Bacteria 3735
15 Ga0068857_100080268 3300005577 Unclassified 2913
16 Ga0068852_100024265 3300005616 Bacteria 4898
17 Ga0068859_100036364 3300005617 Unclassified 4944
18 Ga0068858_100004836 3300005842 Bacteria 13200
19 Ga0068858_100043331 3300005842 Bacteria 4173
20 Ga0068860_100014156 3300005843 Bacteria 7823
21 Ga0068860_100075473 3300005843 Unclassified 3206
22 Ga0081539_10004214 3300005985 Bacteria 16212
23 Ga0070717_10341541 3300006028 Bacteria 1337
24 Ga0075365_10000213 3300006038 Bacteria 19493
25 Ga0075363_100011798 3300006048 Bacteria 4194
26 Ga0075364_10183120 3300006051 Bacteria 1418
27 Ga0075367_10002272 3300006178 Bacteria 8708
28 Ga0075366_10083228 3300006195 Bacteria 1912
29 Ga0075370_10016273 3300006353 Bacteria 4000
30 Ga0068871_100063800 3300006358 Bacteria 3014
31 Ga0068871_100244131 3300006358 Bacteria 1562
32 Ga0075428_100037855 3300006844 Bacteria 5308
33 Ga0075431_100009343 3300006847 Bacteria 9843
34 Ga0075429_100024722 3300006880 Bacteria 5213
35 Ga0068865_100007375 3300006881 Bacteria 6766
36 Ga0068865_100053115 3300006881 Bacteria 2811
37 Ga0097620_100036364 3300006931 Unclassified 4944
38 Ga0075435_100012365 3300007076 Bacteria 6317
39 Ga0105240_10085542 3300009093 Bacteria 3863
40 Ga0105240_10108150 3300009093 Bacteria 3369
41 Ga0105240_10155145 3300009093 Unclassified 2724
42 Ga0105245_10048670 3300009098 Unclassified 3792
43 Ga0105245_10057239 3300009098 Unclassified 3506
44 Ga0105245_10072689 3300009098 Unclassified 3125
45 Ga0114129_10100158 3300009147 Bacteria 4009
46 Ga0114129_10389732 3300009147 Bacteria 1838
47 Ga0105241_10039982 3300009174 Bacteria 3539
48 Ga0105242_10020519 3300009176 Bacteria 5182
49 Ga0105242_10060673 3300009176 Bacteria 3108
50 Ga0105242_10095131 3300009176 Unclassified 2514
51 Ga0105242_10129156 3300009176 Bacteria 2179
52 Ga0105248_10011182 3300009177 Bacteria 9900
53 Ga0105248_10429454 3300009177 Unclassified 1488
54 Ga0105248_10642045 3300009177 Unclassified 1198
55 Ga0105237_10087906 3300009545 Bacteria 3097
56 Ga0105238_10025775 3300009551 Bacteria 5995
57 Ga0105238_10133999 3300009551 Bacteria 2455
58 Ga0105249_10025248 3300009553 Bacteria 5347
59 Ga0105249_10076687 3300009553 Bacteria 3099
60 Ga0105239_10251463 3300010375 Unclassified 1985
61 Ga0157369_10536938 3300013105 Bacteria 1209
62 Ga0157374_10126479 3300013296 Bacteria 2471
63 Ga0157378_10372076 3300013297 Unclassified 1401
64 Ga0163162_10010016 3300013306 Bacteria 9215
65 Ga0163162_10369436 3300013306 Unclassified 1567
66 Ga0157375_10191512 3300013308 Bacteria 2200
67 Ga0163163_10115918 3300014325 Unclassified 2710
68 Ga0163163_10236267 3300014325 Unclassified 1877
69 Ga0157379_10013682 3300014968 Bacteria 7110
70 Ga0213874_10009900 3300021377 Bacteria 2372
71 Ga0213875_10023867 3300021388 Unclassified 2918
72 Ga0213875_10045368 3300021388 Bacteria 2063
73 Ga0213875_10115149 3300021388 Bacteria 1256
74 Ga0207654_10074918 3300025911 Bacteria 2021
75 Ga0207707_10346154 3300025912 Bacteria 1281
76 Ga0207695_10073756 3300025913 Unclassified 3476
77 Ga0207695_10146621 3300025913 Bacteria 2304
78 Ga0207695_10240207 3300025913 Bacteria 1713
79 Ga0207660_10112984 3300025917 Unclassified 2047
80 Ga0207657_10438477 3300025919 Unclassified 1025
81 Ga0207646_10034089 3300025922 Unclassified 4601
82 Ga0207694_10016943 3300025924 Bacteria 5505
83 Ga0207694_10234094 3300025924 Bacteria 1500
84 Ga0207700_10069215 3300025928 Bacteria 2708
85 Ga0207704_10048247 3300025938 Bacteria 2552
86 Ga0207704_10378469 3300025938 Unclassified 1110
87 Ga0207711_10294104 3300025941 Bacteria 1497
88 Ga0207689_10043960 3300025942 Bacteria 3693
89 Ga0207661_10104272 3300025944 Bacteria 2387
90 Ga0207667_10011004 3300025949 Bacteria 10542
91 Ga0207667_10076312 3300025949 Bacteria 3478
92 Ga0207651_10026657 3300025960 Unclassified 3615
93 Ga0207712_10024753 3300025961 Bacteria 3981
94 Ga0207703_10162302 3300026035 Bacteria 1958
95 Ga0207639_10171825 3300026041 Unclassified 1836
96 Ga0207674_10042005 3300026116 Bacteria 4725
97 Ga0207698_10032575 3300026142 Bacteria 3778
98 Ga0209813_10030461 3300027866 Bacteria 1586
99 Ga0268264_10004081 3300028381 Bacteria 12505
100 Ga0268264_10042881 3300028381 Unclassified 3747
101 Ga0265340_10024580 3300031247 Unclassified 3059
102 Ga0265313_10022233 3300031595 Bacteria 3446
103 Ga0265314_10003172 3300031711 Bacteria 16107
104 Ga0373937_0206190 3300036401 Unclassified 1849
105 Ga0436364_0035001 3300037853 Unclassified 3196
106 Ga0436364_0189721 3300037853 Bacteria 18528
107 Ga0436364_0255232 3300037853 Bacteria 5062
108 Ga0436364_0487092 3300037853 Bacteria 2546
109 Ga0436364_1229372 3300037853 Bacteria 1881
110 Ga0436364_1315484 3300037853 Bacteria 5883
111 Ga0436365_0811984 3300039437 Bacteria 1129
112 Ga0436360_0015841 3300039438 Unclassified 1504
113 Ga0436363_0418949 3300039450 Bacteria 3311
114 Ga0436363_0558701 3300039450 Bacteria 1783
115 Ga0439433_0021177 3300041999 Bacteria 1453
116 Ga0439446_0005233 3300042156 Bacteria 3329
117 Ga0451577_0006493 3300042876 Bacteria 11647
118 Ga0451577_0524233 3300042876 Bacteria 1076
119 Ga0453684_0000003 3300044712 Bacteria 1481694
120 Ga0453684_0024418 3300044712 Bacteria 8837
121 Ga0453684_0042749 3300044712 Bacteria 6103
122 Ga0453684_0047432 3300044712 Bacteria 5698
123 Ga0453684_0175747 3300044712 Unclassified 2519
124 Ga0451576_0662190 3300045051 Bacteria 1097
125 Ga0495592_0239251 3300046454 Unclassified 1205
126 Ga0495651_0162692 3300046462 Unclassified 1597
127 Ga0495662_0053183 3300046476 Unclassified 1956
128 Ga0495628_0011541 3300046516 Bacteria 7469
129 Ga0495666_0208109 3300046526 Unclassified 898
130 Ga0495652_0045699 3300046529 Unclassified 3762
131 Ga0495587_0089888 3300046536 Unclassified 1774
132 Ga0495645_0005159 3300046543 Bacteria 8943
133 Ga0495667_0086313 3300046559 Unclassified 2035
134 Ga0495634_0085436 3300046642 Unclassified 2056
135 Ga0495635_0006801 3300046663 Bacteria 7992
136 Ga0495599_0001416 3300046678 Bacteria 13730
137 Ga0495646_0156517 3300046680 Unclassified 1264
138 Ga0495613_0023172 3300046689 Unclassified 4626
139 Ga0495600_0137209 3300046809 Unclassified 1588
140 Ga0495581_0014652 3300047315 Unclassified 4546
141 Ga0495593_0220282 3300047673 Bacteria 952
142 Ga0501034_0002519 3300049571 Bacteria 21964
143 Ga0501034_0322252 3300049571 Bacteria 1478
144 Ga0501047_0066229 3300049581 Bacteria 3482
145 nmdc:mga00v17_186341_c1 3300050491 Unclassified 1339
146 nmdc:mga0yw44_10932_c1 3300050492 Bacteria 4655
147 nmdc:mga07m45_99266_c1 3300050496 Bacteria 1672
148 nmdc:mga05p37_73348_c1 3300050507 Bacteria 4212
149 nmdc:mga09592_95833_c1 3300050508 Bacteria 2539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_10438477 Ga0207657_104384772 267
2 3300047673 Ga0495593_0220282 Ga0495593_0220282_44_868 274
3 3300046454 Ga0495592_0239251 Ga0495592_0239251_274_1119 275
4 3300046526 Ga0495666_0208109 Ga0495666_0208109_38_883 275
5 3300039438 Ga0436360_0015841 Ga0436360_0015841_190_1071 281
6 3300005334 Ga0068869_100032262 Ga0068869_1000322622 289
7 3300025942 Ga0207689_10043960 Ga0207689_100439602 289
8 3300013306 Ga0163162_10010016 Ga0163162_100100168 291
9 3300006881 Ga0068865_100007375 Ga0068865_1000073755 292
10 3300028381 Ga0268264_10004081 Ga0268264_100040812 295
11 3300005617 Ga0068859_100036364 Ga0068859_1000363642 296
12 3300006931 Ga0097620_100036364 Ga0097620_1000363642 296
13 3300009098 Ga0105245_10057239 Ga0105245_100572392 296
14 3300013297 Ga0157378_10372076 Ga0157378_103720761 296
15 3300014325 Ga0163163_10236267 Ga0163163_102362672 297
16 3300013306 Ga0163162_10369436 Ga0163162_103694362 298
17 3300009098 Ga0105245_10048670 Ga0105245_100486703 299
18 3300009176 Ga0105242_10020519 Ga0105242_100205191 299
19 3300031711 Ga0265314_10003172 Ga0265314_1000317210 299
20 3300005545 Ga0070695_100087815 Ga0070695_1000878152 301
21 3300045051 Ga0451576_0662190 Ga0451576_0662190_118_1059 301
22 3300049571 Ga0501034_0002519 Ga0501034_0002519_13449_14393 301
23 3300006358 Ga0068871_100244131 Ga0068871_1002441312 302
24 3300009177 Ga0105248_10642045 Ga0105248_106420451 302
25 3300013308 Ga0157375_10191512 Ga0157375_101915122 302
26 3300009176 Ga0105242_10129156 Ga0105242_101291562 303
27 3300009553 Ga0105249_10076687 Ga0105249_100766872 303
28 3300025938 Ga0207704_10378469 Ga0207704_103784691 303
29 3300031247 Ga0265340_10024580 Ga0265340_100245802 304
30 3300006195 Ga0075366_10083228 Ga0075366_100832281 306
31 3300044712 Ga0453684_0047432 Ga0453684_0047432_1958_2905 306
32 3300005539 Ga0068853_100238040 Ga0068853_1002380402 309
33 3300005548 Ga0070665_100060203 Ga0070665_1000602032 309
34 3300005563 Ga0068855_100000992 Ga0068855_1000009925 309
35 3300005616 Ga0068852_100024265 Ga0068852_1000242655 309
36 3300005842 Ga0068858_100043331 Ga0068858_1000433312 309
37 3300005843 Ga0068860_100075473 Ga0068860_1000754732 309
38 3300009093 Ga0105240_10108150 Ga0105240_101081502 309
39 3300009093 Ga0105240_10155145 Ga0105240_101551454 309
40 3300009176 Ga0105242_10095131 Ga0105242_100951312 309
41 3300009551 Ga0105238_10133999 Ga0105238_101339993 309
42 3300009553 Ga0105249_10025248 Ga0105249_100252487 309
43 3300010375 Ga0105239_10251463 Ga0105239_102514632 309
44 3300025913 Ga0207695_10073756 Ga0207695_100737562 309
45 3300025913 Ga0207695_10146621 Ga0207695_101466212 309
46 3300025917 Ga0207660_10112984 Ga0207660_101129842 309
47 3300025949 Ga0207667_10011004 Ga0207667_100110042 309
48 3300025961 Ga0207712_10024753 Ga0207712_100247537 309
49 3300026041 Ga0207639_10171825 Ga0207639_101718252 309
50 3300026142 Ga0207698_10032575 Ga0207698_100325752 309
51 3300005329 Ga0070683_100233713 Ga0070683_1002337132 310
52 3300009551 Ga0105238_10025775 Ga0105238_100257753 310
53 3300021388 Ga0213875_10115149 Ga0213875_101151492 310
54 3300025924 Ga0207694_10016943 Ga0207694_100169432 310
55 3300031595 Ga0265313_10022233 Ga0265313_100222332 310
56 3300037853 Ga0436364_0035001 Ga0436364_0035001_193_1152 310
57 3300037853 Ga0436364_0255232 Ga0436364_0255232_776_1816 310
58 3300005364 Ga0070673_100010356 Ga0070673_1000103564 311
59 3300007076 Ga0075435_100012365 Ga0075435_1000123655 311
60 3300050507 nmdc:mga05p37_73348_c1 nmdc:mga05p37_73348_c1_2707_3678 311
61 3300006048 Ga0075363_100011798 Ga0075363_1000117982 312
62 3300006178 Ga0075367_10002272 Ga0075367_100022722 312
63 3300006353 Ga0075370_10016273 Ga0075370_100162733 312
64 3300027866 Ga0209813_10030461 Ga0209813_100304612 312
65 3300046476 Ga0495662_0053183 Ga0495662_0053183_979_1935 312
66 3300046809 Ga0495600_0137209 Ga0495600_0137209_37_993 312
67 3300025960 Ga0207651_10026657 Ga0207651_100266573 313
68 3300039450 Ga0436363_0558701 Ga0436363_0558701_703_1689 314
69 3300006358 Ga0068871_100063800 Ga0068871_1000638001 315
70 3300014325 Ga0163163_10115918 Ga0163163_101159182 315
71 3300044712 Ga0453684_0042749 Ga0453684_0042749_2118_3125 316
72 3300046689 Ga0495613_0023172 Ga0495613_0023172_103_1134 316
73 3300047315 Ga0495581_0014652 Ga0495581_0014652_3355_4386 316
74 3300005577 Ga0068857_100080268 Ga0068857_1000802683 317
75 3300006028 Ga0070717_10341541 Ga0070717_103415412 317
76 3300026116 Ga0207674_10042005 Ga0207674_100420053 317
77 3300005468 Ga0070707_100108391 Ga0070707_1001083912 318
78 3300050491 nmdc:mga00v17_186341_c1 nmdc:mga00v17_186341_c1_246_1205 318
79 3300006844 Ga0075428_100037855 Ga0075428_1000378552 319
80 3300006847 Ga0075431_100009343 Ga0075431_1000093438 319
81 3300006880 Ga0075429_100024722 Ga0075429_1000247222 319
82 3300009147 Ga0114129_10389732 Ga0114129_103897322 319
83 3300050492 nmdc:mga0yw44_10932_c1 nmdc:mga0yw44_10932_c1_3616_4599 319
84 3300050496 nmdc:mga07m45_99266_c1 nmdc:mga07m45_99266_c1_115_1098 319
85 3300050508 nmdc:mga09592_95833_c1 nmdc:mga09592_95833_c1_482_1510 319
86 3300006881 Ga0068865_100053115 Ga0068865_1000531153 320
87 3300025938 Ga0207704_10048247 Ga0207704_100482473 320
88 3300025941 Ga0207711_10294104 Ga0207711_102941042 320
89 3300042876 Ga0451577_0524233 Ga0451577_0524233_28_1050 320
90 3300044712 Ga0453684_0024418 Ga0453684_0024418_208_1230 320
91 3300005364 Ga0070673_100039476 Ga0070673_1000394763 321
92 3300005458 Ga0070681_10144978 Ga0070681_101449782 321
93 3300005563 Ga0068855_100082139 Ga0068855_1000821392 321
94 3300005985 Ga0081539_10004214 Ga0081539_100042145 321
95 3300009093 Ga0105240_10085542 Ga0105240_100855422 321
96 3300009177 Ga0105248_10011182 Ga0105248_100111829 321
97 3300013105 Ga0157369_10536938 Ga0157369_105369382 321
98 3300025913 Ga0207695_10240207 Ga0207695_102402072 321
99 3300025922 Ga0207646_10034089 Ga0207646_100340894 321
100 3300025949 Ga0207667_10076312 Ga0207667_100763122 321
101 3300039450 Ga0436363_0418949 Ga0436363_0418949_387_1364 321
102 3300041999 Ga0439433_0021177 Ga0439433_0021177_195_1226 321
103 3300042156 Ga0439446_0005233 Ga0439446_0005233_2079_3110 321
104 3300009174 Ga0105241_10039982 Ga0105241_100399822 323
105 3300009176 Ga0105242_10060673 Ga0105242_100606732 323
106 3300025911 Ga0207654_10074918 Ga0207654_100749182 323
107 3300025924 Ga0207694_10234094 Ga0207694_102340941 323
108 3300005329 Ga0070683_100003767 Ga0070683_1000037678 324
109 3300005436 Ga0070713_100077488 Ga0070713_1000774882 324
110 3300005535 Ga0070684_100008990 Ga0070684_1000089906 324
111 3300005842 Ga0068858_100004836 Ga0068858_10000483613 324
112 3300005843 Ga0068860_100014156 Ga0068860_1000141564 324
113 3300006038 Ga0075365_10000213 Ga0075365_100002133 324
114 3300006051 Ga0075364_10183120 Ga0075364_101831202 324
115 3300009098 Ga0105245_10072689 Ga0105245_100726891 324
116 3300009147 Ga0114129_10100158 Ga0114129_101001584 324
117 3300009177 Ga0105248_10429454 Ga0105248_104294542 324
118 3300009545 Ga0105237_10087906 Ga0105237_100879062 324
119 3300013296 Ga0157374_10126479 Ga0157374_101264792 324
120 3300014968 Ga0157379_10013682 Ga0157379_100136828 324
121 3300021377 Ga0213874_10009900 Ga0213874_100099002 324
122 3300021388 Ga0213875_10023867 Ga0213875_100238672 324
123 3300021388 Ga0213875_10045368 Ga0213875_100453682 324
124 3300025912 Ga0207707_10346154 Ga0207707_103461541 324
125 3300025928 Ga0207700_10069215 Ga0207700_100692153 324
126 3300025944 Ga0207661_10104272 Ga0207661_101042723 324
127 3300026035 Ga0207703_10162302 Ga0207703_101623022 324
128 3300028381 Ga0268264_10042881 Ga0268264_100428812 324
129 3300036401 Ga0373937_0206190 Ga0373937_0206190_124_1146 324
130 3300037853 Ga0436364_0189721 Ga0436364_0189721_17021_18058 324
131 3300037853 Ga0436364_0487092 Ga0436364_0487092_138_1151 324
132 3300037853 Ga0436364_1229372 Ga0436364_1229372_243_1283 324
133 3300037853 Ga0436364_1315484 Ga0436364_1315484_1236_2270 324
134 3300039437 Ga0436365_0811984 Ga0436365_0811984_71_1090 324
135 3300042876 Ga0451577_0006493 Ga0451577_0006493_2407_3453 324
136 3300044712 Ga0453684_0000003 Ga0453684_0000003_639658_640704 324
137 3300044712 Ga0453684_0175747 Ga0453684_0175747_1302_2297 324
138 3300046462 Ga0495651_0162692 Ga0495651_0162692_375_1397 324
139 3300046516 Ga0495628_0011541 Ga0495628_0011541_5028_6050 324
140 3300046529 Ga0495652_0045699 Ga0495652_0045699_2094_3116 324
141 3300046536 Ga0495587_0089888 Ga0495587_0089888_624_1646 324
142 3300046543 Ga0495645_0005159 Ga0495645_0005159_4726_5748 324
143 3300046559 Ga0495667_0086313 Ga0495667_0086313_338_1360 324
144 3300046642 Ga0495634_0085436 Ga0495634_0085436_190_1212 324
145 3300046663 Ga0495635_0006801 Ga0495635_0006801_2673_3695 324
146 3300046678 Ga0495599_0001416 Ga0495599_0001416_521_1543 324
147 3300046680 Ga0495646_0156517 Ga0495646_0156517_89_1111 324
148 3300049571 Ga0501034_0322252 Ga0501034_0322252_66_1070 324
149 3300049581 Ga0501047_0066229 Ga0501047_0066229_141_1145 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03706

LPG_synthase_TM

Lysylphosphatidylglycerol synthase TM region

30

330

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f47-assembly1.cif.gz_A cryo-em structure of rhizobium etli mprf 0.6585 1 298
7duw-assembly1.cif.gz_B cryo-em structure of the multiple peptide resistance factor (mprf) loaded with two lysyl-phosphatidylglycerol molecules 0.6416 6 322
6lvf-assembly1.cif.gz_A cryo-em structure of the multiple peptide resistance factor (mprf) loaded with one lysyl-phosphatidylglycerol molecule 0.601 6 314
7duw-assembly1.cif.gz_B cryo-em structure of the multiple peptide resistance factor (mprf) loaded with two lysyl-phosphatidylglycerol molecules 0.5931 6 322
7f47-assembly1.cif.gz_A cryo-em structure of rhizobium etli mprf 0.5785 1 298
ID Description Score Start End Superfamily
af_E9QCC0_24_150_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4643 113 226 1.20.58.70
3lg7B00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4564 112 223 1.20.58.70
af_O16000_28_156_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4431 112 223 1.20.58.70
af_Q2G0C3_21_158_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4415 184 318 1.10.1760.20
1ez3B00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4343 122 223 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A7Y5TYS4-F1-model_v4 Flippase-like domain-containing protein 0.9835 4 315 GO:0005886
AF-A0A521TYM1-F1-model_v4 Flippase-like domain-containing protein 0.9818 11 323 GO:0005886
AF-A0A2V8J3G9-F1-model_v4 Flippase-like domain-containing protein 0.9812 1 320 GO:0005886
AF-A0A3N5WY59-F1-model_v4 UPF0104 family protein 0.973 9 315 GO:0005886
AF-A0A6L9IIN7-F1-model_v4 Flippase-like domain-containing protein 0.9666 1 314 GO:0005886

Feature Viewer

pLDDT pTM Quality
88.95 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map