F205460

General Info

Members Datasets Scaffolds Average Seq Length
149 105 298 73

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_101574823|Ga0070693_1015748231
Length 87
Sequence MRNQKVTLRLMSTDNPGSATDLVRNSSLYREFQAEREEILKHKWIESEKVGYDIGFERALTDWIIKHRSKWRKSRQALNTQVTQPAN

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
72 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
101 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.01
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 54.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_101574823 3300005547 Unclassified 515
2 CNXas_1001836 3300000545 Bacteria 1446
3 Ga0065707_10643032 3300005295 Unclassified 667
4 Ga0070683_100741062 3300005329 Unclassified 941
5 Ga0070690_100498029 3300005330 Unclassified 911
6 Ga0070689_100077112 3300005340 Bacteria 2611
7 Ga0070689_100284406 3300005340 Unclassified 1373
8 Ga0070689_100556015 3300005340 Unclassified 989
9 Ga0070689_100625849 3300005340 Unclassified 934
10 Ga0070687_100083879 3300005343 Bacteria 1746
11 Ga0070692_10149160 3300005345 Unclassified 1330
12 Ga0070669_100750291 3300005353 Unclassified 827
13 Ga0070673_101486042 3300005364 Unclassified 639
14 Ga0070688_100294197 3300005365 Bacteria 1171
15 Ga0070688_101816690 3300005365 Unclassified 500
16 Ga0070709_10077673 3300005434 Bacteria 2159
17 Ga0070713_100587224 3300005436 Unclassified 1057
18 Ga0070713_101503993 3300005436 Bacteria 653
19 Ga0070710_10369296 3300005437 Unclassified 954
20 Ga0070701_10010422 3300005438 Bacteria 4110
21 Ga0070705_100949133 3300005440 Unclassified 695
22 Ga0070694_100702189 3300005444 Bacteria 822
23 Ga0070694_101913670 3300005444 Unclassified 506
24 Ga0070681_10700689 3300005458 Unclassified 928
25 Ga0070685_10315070 3300005466 Unclassified 1058
26 Ga0070707_101407941 3300005468 Unclassified 664
27 Ga0070684_100388933 3300005535 Bacteria 1285
28 Ga0070697_101013719 3300005536 Bacteria 738
29 Ga0070672_100639978 3300005543 Bacteria 928
30 Ga0070686_100029478 3300005544 Bacteria 3339
31 Ga0070686_101271743 3300005544 Unclassified 614
32 Ga0070695_100039423 3300005545 Bacteria 2986
33 Ga0068855_102281669 3300005563 Unclassified 542
34 Ga0068857_100036059 3300005577 Bacteria 4382
35 Ga0068857_102385590 3300005577 Unclassified 519
36 Ga0068856_101425400 3300005614 Unclassified 707
37 Ga0068852_102145349 3300005616 Unclassified 580
38 Ga0068859_100161491 3300005617 Bacteria 2320
39 Ga0068864_100045406 3300005618 Bacteria 3769
40 Ga0068864_101240553 3300005618 Unclassified 745
41 Ga0068864_102589820 3300005618 Unclassified 513
42 Ga0068863_101569515 3300005841 Unclassified 667
43 Ga0068863_101660803 3300005841 Unclassified 648
44 Ga0068862_101869727 3300005844 Unclassified 610
45 Ga0070715_10335735 3300006163 Bacteria 820
46 Ga0075428_100335799 3300006844 Bacteria 1623
47 Ga0075433_10845045 3300006852 Unclassified 799
48 Ga0075434_102170428 3300006871 Unclassified 559
49 Ga0097620_100161488 3300006931 Bacteria 2320
50 Ga0105240_10000765 3300009093 Bacteria 58427
51 Ga0111539_10789935 3300009094 Bacteria 1105
52 Ga0111539_10809201 3300009094 Unclassified 1090
53 Ga0111539_11436644 3300009094 Unclassified 800
54 Ga0111539_12913599 3300009094 Unclassified 554
55 Ga0105245_10623903 3300009098 Bacteria 1106
56 Ga0105247_10730317 3300009101 Unclassified 748
57 Ga0105249_10197579 3300009553 Unclassified 1966
58 Ga0105239_11102874 3300010375 Bacteria 914
59 Ga0157374_10858025 3300013296 Unclassified 925
60 Ga0157374_11251771 3300013296 Bacteria 764
61 Ga0163162_10477033 3300013306 Unclassified 1379
62 Ga0157375_12349732 3300013308 Unclassified 636
63 Ga0163163_10000083 3300014325 Bacteria 104503
64 Ga0163163_10021674 3300014325 Bacteria 6067
65 Ga0163163_11206746 3300014325 Unclassified 819
66 Ga0157380_12446958 3300014326 Unclassified 588
67 Ga0157379_10563969 3300014968 Bacteria 1060
68 Ga0157379_11828342 3300014968 Unclassified 597
69 Ga0157379_12521581 3300014968 Unclassified 514
70 Ga0207692_10302958 3300025898 Unclassified 973
71 Ga0207643_10593188 3300025908 Unclassified 713
72 Ga0207684_11695665 3300025910 Unclassified 509
73 Ga0207695_10021367 3300025913 Bacteria 7384
74 Ga0207695_10462542 3300025913 Bacteria 1151
75 Ga0207662_10176288 3300025918 Unclassified 1374
76 Ga0207662_10448290 3300025918 Bacteria 882
77 Ga0207652_10291684 3300025921 Bacteria 1472
78 Ga0207646_11760388 3300025922 Bacteria 531
79 Ga0207670_10683922 3300025936 Unclassified 848
80 Ga0207711_11898822 3300025941 Unclassified 538
81 Ga0207661_12099624 3300025944 Unclassified 511
82 Ga0207712_11128243 3300025961 Unclassified 698
83 Ga0207708_11999677 3300026075 Unclassified 507
84 Ga0207702_11103227 3300026078 Unclassified 787
85 Ga0207702_12325287 3300026078 Unclassified 524
86 Ga0207641_10135310 3300026088 Bacteria 2218
87 Ga0207641_12132950 3300026088 Unclassified 561
88 Ga0265334_10254112 3300028573 Bacteria 605
89 Ga0265338_10283276 3300028800 Unclassified 1210
90 Ga0265324_10219412 3300029957 Unclassified 646
91 Ga0265316_10238105 3300031344 Bacteria 1339
92 Ga0307406_11573261 3300031901 Unclassified 580
93 Ga0307409_101140054 3300031995 Unclassified 802
94 Ga0373926_0015888 3300035083 Bacteria 2570
95 Ga0373932_0417310 3300035112 Unclassified 522
96 Ga0373945_0040437 3300035116 Bacteria 1683
97 Ga0373943_0305410 3300035170 Unclassified 904
98 Ga0373943_0818635 3300035170 Unclassified 555
99 Ga0373962_0165292 3300035242 Unclassified 732
100 Ga0373931_0082011 3300035691 Bacteria 1782
101 Ga0373935_0039874 3300035692 Bacteria 2945
102 Ga0373935_0272872 3300035692 Unclassified 1189
103 Ga0373927_0030517 3300035695 Bacteria 3516
104 Ga0373927_0177712 3300035695 Unclassified 1396
105 Ga0373927_0951142 3300035695 Unclassified 567
106 Ga0373927_1188844 3300035695 Unclassified 503
107 Ga0373933_0659756 3300035724 Unclassified 688
108 Ga0373947_0031162 3300035725 Bacteria 3137
109 Ga0373947_0571129 3300035725 Unclassified 770
110 Ga0373937_2010955 3300036401 Unclassified 524
111 Ga0373925_0007573 3300037068 Bacteria 7909
112 Ga0373925_0185985 3300037068 Bacteria 1647
113 Ga0451807_2654079 3300041486 Bacteria 799
114 Ga0451577_0026111 3300042876 Bacteria 5291
115 Ga0451577_0223024 3300042876 Bacteria 1704
116 Ga0451577_0338540 3300042876 Bacteria 1365
117 Ga0451577_0545225 3300042876 Bacteria 1053
118 Ga0451577_0934970 3300042876 Bacteria 780
119 Ga0453684_0011804 3300044712 Bacteria 14555
120 Ga0453684_0502624 3300044712 Bacteria 1342
121 Ga0453684_0565753 3300044712 Bacteria 1250
122 Ga0453684_0728251 3300044712 Bacteria 1075
123 Ga0453684_1744678 3300044712 Unclassified 635
124 Ga0451576_0055217 3300045051 Bacteria 4156
125 Ga0451576_0269709 3300045051 Unclassified 1779
126 Ga0451576_0495072 3300045051 Bacteria 1284
127 Ga0451576_0515284 3300045051 Bacteria 1256
128 Ga0451576_1300277 3300045051 Unclassified 758
129 Ga0495592_0134717 3300046454 Bacteria 1724
130 Ga0495628_0134412 3300046516 Bacteria 1891
131 Ga0495630_0018069 3300046517 Bacteria 5175
132 Ga0495640_0754658 3300046533 Bacteria 582
133 Ga0495586_0077448 3300046535 Bacteria 1823
134 Ga0495586_0324138 3300046535 Unclassified 884
135 Ga0495645_0495076 3300046543 Bacteria 765
136 Ga0495659_0401911 3300046664 Bacteria 591
137 Ga0495599_0043291 3300046678 Bacteria 2825
138 Ga0495599_0203497 3300046678 Bacteria 1216
139 Ga0495669_0414148 3300046684 Unclassified 653
140 Ga0495675_0019886 3300047444 Unclassified 4267
141 Ga0495684_0785061 3300047471 Bacteria 624
142 Ga0496112_1511497 3300048915 Unclassified 585
143 Ga0496113_1249387 3300048916 Unclassified 579
144 Ga0501257_069316 3300049686 Bacteria 899
145 Ga0501245_091586 3300049708 Unclassified 603
146 Ga0501044_0759006 3300049823 Bacteria 852
147 nmdc:mga08y16_1387712_c1 3300050511 Unclassified 666
148 nmdc:mga0n895_2131476_c1 3300050512 Unclassified 517
149 Ga0495595_0444593 3300053084 Unclassified 659
150 Ga0070693_101574823
151 CNXas_1001836
152 Ga0065707_10643032
153 Ga0070683_100741062
154 Ga0070690_100498029
155 Ga0070689_100077112
156 Ga0070689_100284406
157 Ga0070689_100556015
158 Ga0070689_100625849
159 Ga0070687_100083879
160 Ga0070692_10149160
161 Ga0070669_100750291
162 Ga0070673_101486042
163 Ga0070688_100294197
164 Ga0070688_101816690
165 Ga0070709_10077673
166 Ga0070713_100587224
167 Ga0070713_101503993
168 Ga0070710_10369296
169 Ga0070701_10010422
170 Ga0070705_100949133
171 Ga0070694_100702189
172 Ga0070694_101913670
173 Ga0070681_10700689
174 Ga0070685_10315070
175 Ga0070707_101407941
176 Ga0070684_100388933
177 Ga0070697_101013719
178 Ga0070672_100639978
179 Ga0070686_100029478
180 Ga0070686_101271743
181 Ga0070695_100039423
182 Ga0068855_102281669
183 Ga0068857_100036059
184 Ga0068857_102385590
185 Ga0068856_101425400
186 Ga0068852_102145349
187 Ga0068859_100161491
188 Ga0068864_100045406
189 Ga0068864_101240553
190 Ga0068864_102589820
191 Ga0068863_101569515
192 Ga0068863_101660803
193 Ga0068862_101869727
194 Ga0070715_10335735
195 Ga0075428_100335799
196 Ga0075433_10845045
197 Ga0075434_102170428
198 Ga0097620_100161488
199 Ga0105240_10000765
200 Ga0111539_10789935
201 Ga0111539_10809201
202 Ga0111539_11436644
203 Ga0111539_12913599
204 Ga0105245_10623903
205 Ga0105247_10730317
206 Ga0105249_10197579
207 Ga0105239_11102874
208 Ga0157374_10858025
209 Ga0157374_11251771
210 Ga0163162_10477033
211 Ga0157375_12349732
212 Ga0163163_10000083
213 Ga0163163_10021674
214 Ga0163163_11206746
215 Ga0157380_12446958
216 Ga0157379_10563969
217 Ga0157379_11828342
218 Ga0157379_12521581
219 Ga0207692_10302958
220 Ga0207643_10593188
221 Ga0207684_11695665
222 Ga0207695_10021367
223 Ga0207695_10462542
224 Ga0207662_10176288
225 Ga0207662_10448290
226 Ga0207652_10291684
227 Ga0207646_11760388
228 Ga0207670_10683922
229 Ga0207711_11898822
230 Ga0207661_12099624
231 Ga0207712_11128243
232 Ga0207708_11999677
233 Ga0207702_11103227
234 Ga0207702_12325287
235 Ga0207641_10135310
236 Ga0207641_12132950
237 Ga0265334_10254112
238 Ga0265338_10283276
239 Ga0265324_10219412
240 Ga0265316_10238105
241 Ga0307406_11573261
242 Ga0307409_101140054
243 Ga0373926_0015888
244 Ga0373932_0417310
245 Ga0373945_0040437
246 Ga0373943_0305410
247 Ga0373943_0818635
248 Ga0373962_0165292
249 Ga0373931_0082011
250 Ga0373935_0039874
251 Ga0373935_0272872
252 Ga0373927_0030517
253 Ga0373927_0177712
254 Ga0373927_0951142
255 Ga0373927_1188844
256 Ga0373933_0659756
257 Ga0373947_0031162
258 Ga0373947_0571129
259 Ga0373937_2010955
260 Ga0373925_0007573
261 Ga0373925_0185985
262 Ga0451807_2654079
263 Ga0451577_0026111
264 Ga0451577_0223024
265 Ga0451577_0338540
266 Ga0451577_0545225
267 Ga0451577_0934970
268 Ga0453684_0011804
269 Ga0453684_0502624
270 Ga0453684_0565753
271 Ga0453684_0728251
272 Ga0453684_1744678
273 Ga0451576_0055217
274 Ga0451576_0269709
275 Ga0451576_0495072
276 Ga0451576_0515284
277 Ga0451576_1300277
278 Ga0495592_0134717
279 Ga0495628_0134412
280 Ga0495630_0018069
281 Ga0495640_0754658
282 Ga0495586_0077448
283 Ga0495586_0324138
284 Ga0495645_0495076
285 Ga0495659_0401911
286 Ga0495599_0043291
287 Ga0495599_0203497
288 Ga0495669_0414148
289 Ga0495675_0019886
290 Ga0495684_0785061
291 Ga0496112_1511497
292 Ga0496113_1249387
293 Ga0501257_069316
294 Ga0501245_091586
295 Ga0501044_0759006
296 nmdc:mga08y16_1387712_c1
297 nmdc:mga0n895_2131476_c1
298 Ga0495595_0444593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u2m-assembly1.cif.gz_B crystal structure of skp 0.7535 11 68
2osz-assembly2.cif.gz_C structure of nup58/45 suggests flexible nuclear pore diameter by intermolecular sliding 0.7493 10 70
7zdr-assembly1.cif.gz_C if(apo/as isolated) conformation of cyddc mutant (h85a.c) in amp-pnp(cydd) bound state (dataset-16) 0.6521 6 71
3k9a-assembly1.cif.gz_A crystal structure of hiv gp41 with mper 0.65 11 72
2osz-assembly2.cif.gz_C structure of nup58/45 suggests flexible nuclear pore diameter by intermolecular sliding 0.6397 10 70
ID Description Score Start End Superfamily
2oszC00 Special;Helix non-globular;Helix Hairpins; 0.7493 10 70 6.10.140.1350
3k9aA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.65 11 72 1.10.287.210
2oszC00 Special;Helix non-globular;Helix Hairpins; 0.6397 10 70 6.10.140.1350
5ka6B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5739 11 72 1.10.287.210
3p30A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5706 11 72 1.10.287.210
ID Description Score Start End GO Terms
AF-A0A7S2NAN0-F1-model_v4 Uncharacterized protein 0.7073 5 71
AF-A0A7G3CZV2-F1-model_v4 deleted 0.687 1 73
AF-A0A7G3CZV2-F1-model_v4 deleted 0.6794 1 73
AF-A0A7S2NAN0-F1-model_v4 Uncharacterized protein 0.6556 5 71
AF-B5VN39-F1-model_v4 tRNA-intron lyase (EC 4.6.1.16) (tRNA-intron endonuclease Sen2) 0.5245 1 72 GO:0000213
GO:0000214
GO:0000379
GO:0003676
GO:0005737
GO:0016829

Map