F205124

General Info

Members Datasets Scaffolds Average Seq Length
149 111 298 326

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100107836|Ga0070689_1001078363
Length 346
Sequence LLPSNPRTYTSAHLQLMSHSPVRVAVTGAAGQIGYSLLFRIASGALFGPDQQVVLHLIEIEPALPALQGVVMELDDCAFPLLADVVPTANLDEGFRGVNWALLVGSVPRKQGMERKDLLGINGKIFVGQGRAIQQNAAPDVRVLVVGNPCNTNCLIAMSNAPDVPRDRWHAMTRLDENRAKGLLATKAGLAVTDVTNVAIWGNHSATQYPDFSNAKINGRPATDTIKDQSWLQGDFIATVQQRGAAIIKARGASSAGSAANAILDTVRSIIEPTPASDWHSAGVCSDGSYGVEPGLISSFPVRSDGGKLEVVPGLPIDVFSRARIDASVNELKEEKSMVAELLARH

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
28 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
42 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
54 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
55 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
56 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
57 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
58 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
59 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
103 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
109 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0
Rhizoplane 2.68
Rhizosphere 87.25
Stem 0
Stem Tuber 0
Unclassified 3.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100107836 3300005340 Bacteria 2212
2 JGI25404J52841_10007596 3300003659 Bacteria 2296
3 Ga0070658_10001371 3300005327 Bacteria 20834
4 Ga0070690_100150841 3300005330 Bacteria 1586
5 Ga0070689_100016431 3300005340 Bacteria 5416
6 Ga0070689_100022132 3300005340 Bacteria 4744
7 Ga0070689_100048405 3300005340 Bacteria 3279
8 Ga0070689_100052157 3300005340 Bacteria 3163
9 Ga0070687_100123140 3300005343 Bacteria 1486
10 Ga0070688_100055880 3300005365 Bacteria 2477
11 Ga0070711_100085307 3300005439 Bacteria 2262
12 Ga0070694_100017042 3300005444 Bacteria 4585
13 Ga0070708_100141448 3300005445 Bacteria 2231
14 Ga0070704_100001090 3300005549 Bacteria 14087
15 Ga0068855_100128960 3300005563 Bacteria 2890
16 Ga0068855_100712945 3300005563 Bacteria 1073
17 Ga0068859_100189515 3300005617 Bacteria 2141
18 Ga0068863_100041131 3300005841 Bacteria 4394
19 Ga0081538_10000023 3300005981 Bacteria 131101
20 Ga0081540_1000358 3300005983 Bacteria 46046
21 Ga0075365_10000493 3300006038 Bacteria 15046
22 Ga0075365_10043041 3300006038 Bacteria 2955
23 Ga0075364_10002586 3300006051 Bacteria 10144
24 Ga0075428_100017762 3300006844 Bacteria 7860
25 Ga0075428_100070591 3300006844 Bacteria 3818
26 Ga0075428_100556724 3300006844 Bacteria 1226
27 Ga0075430_100266914 3300006846 Bacteria 1417
28 Ga0075431_100004630 3300006847 Bacteria 13508
29 Ga0075434_100070693 3300006871 Bacteria 3481
30 Ga0097620_100189515 3300006931 Bacteria 2141
31 Ga0111539_10079741 3300009094 Bacteria 3851
32 Ga0111539_10207766 3300009094 Bacteria 2282
33 Ga0111539_10302253 3300009094 Bacteria 1862
34 Ga0105237_10002879 3300009545 Bacteria 20911
35 Ga0157370_10103542 3300013104 Bacteria 2664
36 Ga0157372_10098326 3300013307 Bacteria 3339
37 Ga0213874_10023545 3300021377 Bacteria 1719
38 Ga0213876_10000851 3300021384 Bacteria 20550
39 Ga0213875_10000086 3300021388 Bacteria 106719
40 Ga0207705_10004316 3300025909 Bacteria 10757
41 Ga0207671_10093977 3300025914 Bacteria 2262
42 Ga0207693_10139352 3300025915 Bacteria 1907
43 Ga0207663_10068043 3300025916 Bacteria 2286
44 Ga0207663_10207749 3300025916 Unclassified 1417
45 Ga0207662_10025826 3300025918 Bacteria 3385
46 Ga0207681_10176424 3300025923 Bacteria 1624
47 Ga0207670_10005487 3300025936 Bacteria 6968
48 Ga0207670_10028541 3300025936 Bacteria 3544
49 Ga0207670_10085656 3300025936 Bacteria 2215
50 Ga0207667_10098330 3300025949 Bacteria 3020
51 Ga0207702_10004230 3300026078 Bacteria 12823
52 Ga0207641_10004274 3300026088 Bacteria 12416
53 Ga0207641_10022583 3300026088 Bacteria 5179
54 Ga0207428_10106611 3300027907 Bacteria 2160
55 Ga0207428_10260633 3300027907 Unclassified 1291
56 Ga0265356_1002581 3300028017 Bacteria 2387
57 Ga0268265_10574875 3300028380 Bacteria 1073
58 Ga0268264_10274653 3300028381 Unclassified 1576
59 Ga0265337_1000109 3300028556 Bacteria 41843
60 Ga0265326_10014378 3300028558 Bacteria 2306
61 Ga0265334_10004775 3300028573 Bacteria 5957
62 Ga0265336_10010597 3300028666 Bacteria 3156
63 Ga0265338_10001410 3300028800 Bacteria 39134
64 Ga0265338_10006950 3300028800 Bacteria 14232
65 Ga0265338_10025937 3300028800 Bacteria 5926
66 Ga0265324_10000382 3300029957 Bacteria 32039
67 Ga0265324_10004333 3300029957 Bacteria 6463
68 Ga0265762_1002447 3300030760 Unclassified 3361
69 Ga0265339_10036896 3300031249 Bacteria 2733
70 Ga0265327_10024269 3300031251 Bacteria 3568
71 Ga0373928_0000932 3300035084 Bacteria 5739
72 Ga0373929_0001750 3300035085 Bacteria 4083
73 Ga0373944_0000013 3300035089 Bacteria 33114
74 Ga0373949_0001926 3300035090 Bacteria 5593
75 Ga0373951_0003243 3300035091 Bacteria 3981
76 Ga0373932_0000001 3300035112 Bacteria 1459067
77 Ga0373945_0010213 3300035116 Bacteria 3088
78 Ga0373956_0007492 3300035119 Bacteria 4396
79 Ga0373962_0000043 3300035242 Bacteria 29210
80 Ga0373931_0000002 3300035691 Bacteria 599830
81 Ga0373935_0101692 3300035692 Bacteria 1896
82 Ga0373927_0005241 3300035695 Bacteria 8970
83 Ga0373947_0014734 3300035725 Bacteria 4485
84 Ga0373947_0079573 3300035725 Bacteria 2026
85 Ga0373937_0221281 3300036401 Unclassified 1782
86 Ga0373925_0000352 3300037068 Bacteria 47960
87 Ga0373925_0002072 3300037068 Bacteria 16511
88 Ga0436364_0985190 3300037853 Bacteria 106787
89 Ga0436365_0413769 3300039437 Bacteria 34100
90 Ga0436363_1386368 3300039450 Bacteria 8268
91 Ga0451577_0024977 3300042876 Bacteria 5427
92 Ga0453684_0199704 3300044712 Bacteria 2332
93 Ga0451576_0053338 3300045051 Bacteria 4236
94 Ga0451576_0069311 3300045051 Bacteria 3670
95 Ga0451576_0244431 3300045051 Bacteria 1875
96 Ga0495592_0028463 3300046454 Bacteria 4232
97 Ga0495582_0048723 3300046473 Bacteria 2333
98 Ga0495662_0089225 3300046476 Bacteria 1502
99 Ga0495608_0006290 3300046511 Bacteria 8423
100 Ga0495628_0000789 3300046516 Bacteria 29129
101 Ga0495630_0000305 3300046517 Bacteria 39378
102 Ga0495630_0012668 3300046517 Bacteria 6129
103 Ga0495666_0023723 3300046526 Bacteria 3033
104 Ga0495652_0012182 3300046529 Bacteria 7768
105 Ga0495640_0030909 3300046533 Bacteria 3829
106 Ga0495640_0063213 3300046533 Bacteria 2508
107 Ga0495586_0000271 3300046535 Bacteria 33410
108 Ga0495586_0024666 3300046535 Bacteria 3216
109 Ga0495586_0103661 3300046535 Bacteria 1580
110 Ga0495645_0032245 3300046543 Bacteria 3821
111 Ga0495645_0154079 3300046543 Bacteria 1594
112 Ga0495645_0277936 3300046543 Bacteria 1102
113 Ga0495667_0006839 3300046559 Bacteria 7741
114 Ga0495667_0184298 3300046559 Bacteria 1339
115 Ga0495634_0073545 3300046642 Bacteria 2247
116 Ga0495657_0055651 3300046675 Bacteria 2638
117 Ga0495599_0032258 3300046678 Bacteria 3289
118 Ga0495647_0065944 3300046681 Bacteria 1439
119 Ga0495658_0019229 3300046683 Bacteria 3562
120 Ga0495658_0039483 3300046683 Bacteria 2619
121 Ga0495613_0055174 3300046689 Bacteria 2920
122 Ga0495613_0330176 3300046689 Bacteria 1051
123 Ga0495581_0055811 3300047315 Bacteria 2280
124 Ga0495581_0070834 3300047315 Bacteria 2017
125 Ga0495674_0000767 3300047319 Bacteria 30476
126 Ga0495674_0023344 3300047319 Bacteria 5702
127 Ga0495674_0080331 3300047319 Bacteria 2799
128 Ga0496102_0000045 3300048905 Bacteria 186726
129 Ga0496103_0000050 3300048906 Bacteria 152034
130 Ga0496114_0000003 3300048917 Bacteria 630981
131 Ga0496115_0016151 3300048918 Bacteria 5678
132 Ga0496118_0194976 3300048921 Bacteria 1207
133 Ga0496125_0145702 3300048928 Bacteria 1637
134 Ga0501034_0440758 3300049571 Bacteria 1221
135 Ga0501072_0204122 3300049588 Bacteria 1576
136 nmdc:mga00v17_10616_c1 3300050491 Bacteria 5035
137 nmdc:mga0yw44_63625_c1 3300050492 Bacteria 2269
138 nmdc:mga08y16_171641_c1 3300050511 Bacteria 2252
139 nmdc:mga08y16_296567_c1 3300050511 Bacteria 1666
140 nmdc:mga08y16_364615_c1 3300050511 Bacteria 1483
141 nmdc:mga08y16_460930_c1 3300050511 Bacteria 1295
142 nmdc:mga08y16_63786_c1 3300050511 Bacteria 3848
143 nmdc:mga0n895_12124_c1 3300050512 Bacteria 7714
144 nmdc:mga08x19_126971_c1 3300050514 Bacteria 1713
145 nmdc:mga0a205_76784_c1 3300050515 Bacteria 3228
146 Ga0495655_0000004 3300053083 Bacteria 293683
147 Ga0500628_000004 3300053129 Bacteria 202098
148 Ga0500616_0004931 3300053153 Bacteria 9266
149 Ga0501084_0330154 3300054114 Bacteria 1288
150 Ga0070689_100107836
151 JGI25404J52841_10007596
152 Ga0070658_10001371
153 Ga0070690_100150841
154 Ga0070689_100016431
155 Ga0070689_100022132
156 Ga0070689_100048405
157 Ga0070689_100052157
158 Ga0070687_100123140
159 Ga0070688_100055880
160 Ga0070711_100085307
161 Ga0070694_100017042
162 Ga0070708_100141448
163 Ga0070704_100001090
164 Ga0068855_100128960
165 Ga0068855_100712945
166 Ga0068859_100189515
167 Ga0068863_100041131
168 Ga0081538_10000023
169 Ga0081540_1000358
170 Ga0075365_10000493
171 Ga0075365_10043041
172 Ga0075364_10002586
173 Ga0075428_100017762
174 Ga0075428_100070591
175 Ga0075428_100556724
176 Ga0075430_100266914
177 Ga0075431_100004630
178 Ga0075434_100070693
179 Ga0097620_100189515
180 Ga0111539_10079741
181 Ga0111539_10207766
182 Ga0111539_10302253
183 Ga0105237_10002879
184 Ga0157370_10103542
185 Ga0157372_10098326
186 Ga0213874_10023545
187 Ga0213876_10000851
188 Ga0213875_10000086
189 Ga0207705_10004316
190 Ga0207671_10093977
191 Ga0207693_10139352
192 Ga0207663_10068043
193 Ga0207663_10207749
194 Ga0207662_10025826
195 Ga0207681_10176424
196 Ga0207670_10005487
197 Ga0207670_10028541
198 Ga0207670_10085656
199 Ga0207667_10098330
200 Ga0207702_10004230
201 Ga0207641_10004274
202 Ga0207641_10022583
203 Ga0207428_10106611
204 Ga0207428_10260633
205 Ga0265356_1002581
206 Ga0268265_10574875
207 Ga0268264_10274653
208 Ga0265337_1000109
209 Ga0265326_10014378
210 Ga0265334_10004775
211 Ga0265336_10010597
212 Ga0265338_10001410
213 Ga0265338_10006950
214 Ga0265338_10025937
215 Ga0265324_10000382
216 Ga0265324_10004333
217 Ga0265762_1002447
218 Ga0265339_10036896
219 Ga0265327_10024269
220 Ga0373928_0000932
221 Ga0373929_0001750
222 Ga0373944_0000013
223 Ga0373949_0001926
224 Ga0373951_0003243
225 Ga0373932_0000001
226 Ga0373945_0010213
227 Ga0373956_0007492
228 Ga0373962_0000043
229 Ga0373931_0000002
230 Ga0373935_0101692
231 Ga0373927_0005241
232 Ga0373947_0014734
233 Ga0373947_0079573
234 Ga0373937_0221281
235 Ga0373925_0000352
236 Ga0373925_0002072
237 Ga0436364_0985190
238 Ga0436365_0413769
239 Ga0436363_1386368
240 Ga0451577_0024977
241 Ga0453684_0199704
242 Ga0451576_0053338
243 Ga0451576_0069311
244 Ga0451576_0244431
245 Ga0495592_0028463
246 Ga0495582_0048723
247 Ga0495662_0089225
248 Ga0495608_0006290
249 Ga0495628_0000789
250 Ga0495630_0000305
251 Ga0495630_0012668
252 Ga0495666_0023723
253 Ga0495652_0012182
254 Ga0495640_0030909
255 Ga0495640_0063213
256 Ga0495586_0000271
257 Ga0495586_0024666
258 Ga0495586_0103661
259 Ga0495645_0032245
260 Ga0495645_0154079
261 Ga0495645_0277936
262 Ga0495667_0006839
263 Ga0495667_0184298
264 Ga0495634_0073545
265 Ga0495657_0055651
266 Ga0495599_0032258
267 Ga0495647_0065944
268 Ga0495658_0019229
269 Ga0495658_0039483
270 Ga0495613_0055174
271 Ga0495613_0330176
272 Ga0495581_0055811
273 Ga0495581_0070834
274 Ga0495674_0000767
275 Ga0495674_0023344
276 Ga0495674_0080331
277 Ga0496102_0000045
278 Ga0496103_0000050
279 Ga0496114_0000003
280 Ga0496115_0016151
281 Ga0496118_0194976
282 Ga0496125_0145702
283 Ga0501034_0440758
284 Ga0501072_0204122
285 nmdc:mga00v17_10616_c1
286 nmdc:mga0yw44_63625_c1
287 nmdc:mga08y16_171641_c1
288 nmdc:mga08y16_296567_c1
289 nmdc:mga08y16_364615_c1
290 nmdc:mga08y16_460930_c1
291 nmdc:mga08y16_63786_c1
292 nmdc:mga0n895_12124_c1
293 nmdc:mga08x19_126971_c1
294 nmdc:mga0a205_76784_c1
295 Ga0495655_0000004
296 Ga0500628_000004
297 Ga0500616_0004931
298 Ga0501084_0330154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02866

Ldh_1_C

lactate/malate dehydrogenase, alpha/beta C-terminal domain

173

343

0.95

PF00056

Ldh_1_N

lactate/malate dehydrogenase, NAD binding domain

22

169

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tvo-assembly1.cif.gz_B structure of malate dehydrogenase from mycobacterium tuberculosis 0.9951 3 328
4tvo-assembly1.cif.gz_B structure of malate dehydrogenase from mycobacterium tuberculosis 0.9919 3 328
3d5t-assembly2.cif.gz_D crystal structure of malate dehydrogenase from burkholderia pseudomallei 0.9896 2 324
3d5t-assembly2.cif.gz_C crystal structure of malate dehydrogenase from burkholderia pseudomallei 0.9888 2 324
1bdm-assembly1.cif.gz_A the structure at 1.8 angstroms resolution of a single site mutant (t189i) of malate dehydrogenase from thermus flavus with increased enzymatic activity 0.9877 1 328
ID Description Score Start End Superfamily
3d5tB02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9838 155 323 3.90.110.10
af_Q4D123_7_158_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9836 5 148 3.40.50.720
4uuoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9775 3 151 3.40.50.720
7mdhC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9743 2 148 3.40.50.720
af_A0A1D6GPH0_156_306_3.90.110.10 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9704 155 301 3.90.110.10
ID Description Score Start End GO Terms
AF-A0A7K2EB87-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 1.003 2 80 GO:0006108
GO:0030060
AF-A0A6M1ZFR5-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 1.003 3 84 GO:0006108
GO:0030060
AF-A0A7Y6HZS5-F1-model_v4 deleted 1.002 244 328
AF-L7VQR7-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 0.9987 155 328 GO:0006108
GO:0030060
AF-A0A538A8P8-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 0.9986 204 328 GO:0006108
GO:0030060

Map