F204635

General Info

Members Datasets Scaffolds Average Seq Length
148 124 296 279

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8001845381|8001848949
Length 312
Sequence QGAVDGQLTARAPLLGSPPAFRIAGTGLVVTDIETLHTVAELRARVRAWRAAGERVALVPTMGALHAGHVALMDAAHRHADRIIVSIFVNPTQFAPTEDLARYPRTLDADRQKASAAGVDVAFVPDVAEMYPDGFATTISLAGPALGLETDFRPTHFAGVATVVAKLFTQTAPDVALFGEKDYQQLAVVTRMARDLDLPVEVVGVPTMREPDGLALSSRNVYLSAEERRTAPLLHKALTDAAHAIRSGAAVAEAVQAARRTVGDAGFAVDYLEARHAVTLAPVAALGAGPIRLLVAARLGATRLIDNIPVPD

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
58 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
59 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
80 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
81 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
82 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
119 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
120 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
121 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
122 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
123 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
124 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 0.68
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 1.35
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 8.11
Rhizosphere 85.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10039174 3300005335 Bacteria 3157
2 Ga0070680_100004459 3300005336 Bacteria 10544
3 Ga0070660_100232174 3300005339 Bacteria 1501
4 Ga0070687_100017831 3300005343 Bacteria 3274
5 Ga0070675_100106602 3300005354 Bacteria 2366
6 Ga0070673_100085428 3300005364 Bacteria 2569
7 Ga0070688_100194460 3300005365 Bacteria 1415
8 Ga0070667_100065656 3300005367 Bacteria 3081
9 Ga0070711_100031879 3300005439 Bacteria 3502
10 Ga0070681_10035305 3300005458 Bacteria 5023
11 Ga0070685_10015760 3300005466 Bacteria 4017
12 Ga0070707_100070412 3300005468 Bacteria 3369
13 Ga0070707_100270212 3300005468 Bacteria 1653
14 Ga0070698_100024231 3300005471 Bacteria 6332
15 Ga0070699_100052769 3300005518 Bacteria 3518
16 Ga0070679_100002402 3300005530 Bacteria 16981
17 Ga0070665_100112896 3300005548 Bacteria 2720
18 Ga0070665_100163028 3300005548 Bacteria 2231
19 Ga0070664_100145667 3300005564 Bacteria 2088
20 Ga0068857_100014981 3300005577 Bacteria 6763
21 Ga0068859_100027648 3300005617 Bacteria 5689
22 Ga0068858_100381692 3300005842 Bacteria 1352
23 Ga0075365_10104950 3300006038 Bacteria 1938
24 Ga0070712_100277785 3300006175 Bacteria 1348
25 Ga0075430_100107002 3300006846 Bacteria 2333
26 Ga0075431_100378570 3300006847 Bacteria 1420
27 Ga0075434_100116567 3300006871 Bacteria 2684
28 Ga0097620_100027646 3300006931 Bacteria 5689
29 Ga0105242_10010355 3300009176 Bacteria 7151
30 Ga0105248_10106790 3300009177 Bacteria 3157
31 Ga0105239_10318889 3300010375 Bacteria 1752
32 Ga0157375_10232385 3300013308 Bacteria 2003
33 Ga0157379_10281014 3300014968 Bacteria 1515
34 Ga0224712_10001689 3300022467 Bacteria 5224
35 Ga0209676_1019283 3300025292 Bacteria 2349
36 Ga0207680_10023556 3300025903 Bacteria 3364
37 Ga0207645_10198929 3300025907 Bacteria 1318
38 Ga0207660_10094398 3300025917 Bacteria 2223
39 Ga0207657_10277561 3300025919 Bacteria 1331
40 Ga0207652_10040371 3300025921 Bacteria 3963
41 Ga0207650_10018813 3300025925 Bacteria 4851
42 Ga0207687_10554528 3300025927 Bacteria 964
43 Ga0207711_10282535 3300025941 Bacteria 1529
44 Ga0207679_10256611 3300025945 Bacteria 1489
45 Ga0207651_10091976 3300025960 Bacteria 2223
46 Ga0207708_10092755 3300026075 Bacteria 2330
47 Ga0207641_10326350 3300026088 Bacteria 1457
48 Ga0207648_10017622 3300026089 Bacteria 6487
49 Ga0207674_10003965 3300026116 Bacteria 17992
50 Ga0207698_10101152 3300026142 Bacteria 2390
51 Ga0268264_10074438 3300028381 Bacteria 2885
52 Ga0268264_10375817 3300028381 Bacteria 1360
53 Ga0265336_10005498 3300028666 Bacteria 4669
54 Ga0265338_10032186 3300028800 Bacteria 5122
55 Ga0265324_10039140 3300029957 Bacteria 1644
56 Ga0265320_10004551 3300031240 Bacteria 9080
57 Ga0265340_10098806 3300031247 Bacteria 1358
58 Ga0265314_10005976 3300031711 Bacteria 10856
59 Ga0265342_10000197 3300031712 Bacteria 67291
60 Ga0373939_0018659 3300035114 Bacteria 1862
61 Ga0373954_0106907 3300035118 Bacteria 1352
62 Ga0316574_0111370 3300035398 Bacteria 1755
63 Ga0373935_0322077 3300035692 Bacteria 1097
64 Ga0373937_0014641 3300036401 Bacteria 6926
65 Ga0373937_0034862 3300036401 Bacteria 4578
66 Ga0373937_0531297 3300036401 Bacteria 1117
67 Ga0373925_0276410 3300037068 Bacteria 1352
68 Ga0395899_0000013 3300037312 Bacteria 510397
69 Ga0436365_1468445 3300039437 Bacteria 1393
70 Ga0436361_1117852 3300039447 Bacteria 4999
71 Ga0436362_0950054 3300039453 Bacteria 1634
72 Ga0451577_0154987 3300042876 Bacteria 2061
73 Ga0466966_0055080 3300044684 Bacteria 2518
74 Ga0466963_0028084 3300044694 Bacteria 3609
75 Ga0466970_0016273 3300044765 Bacteria 3832
76 Ga0466959_0038877 3300045049 Bacteria 3516
77 Ga0466967_0056793 3300045976 Bacteria 3453
78 Ga0466967_0075928 3300045976 Bacteria 3021
79 Ga0495592_0095604 3300046454 Bacteria 2125
80 Ga0495603_0074194 3300046455 Bacteria 1998
81 Ga0495651_0453122 3300046462 Bacteria 829
82 Ga0495651_0477773 3300046462 Bacteria 801
83 Ga0495582_0013561 3300046473 Bacteria 4487
84 Ga0495608_0247299 3300046511 Bacteria 1113
85 Ga0495586_0004081 3300046535 Bacteria 7829
86 Ga0495598_0004405 3300046537 Bacteria 3046
87 Ga0495621_0007711 3300046539 Bacteria 3196
88 Ga0495622_0089315 3300046557 Bacteria 1416
89 Ga0495658_0061112 3300046683 Bacteria 2162
90 Ga0495658_0072309 3300046683 Bacteria 2005
91 Ga0496104_0300293 3300048907 Bacteria 1518
92 Ga0496108_0003614 3300048911 Bacteria 12383
93 Ga0496108_0367258 3300048911 Bacteria 1256
94 Ga0496108_0749784 3300048911 Bacteria 845
95 Ga0496109_0001430 3300048912 Bacteria 19793
96 Ga0496109_0221983 3300048912 Bacteria 1777
97 Ga0496110_0092159 3300048913 Bacteria 2711
98 Ga0496110_0559699 3300048913 Bacteria 1039
99 Ga0496111_0022530 3300048914 Bacteria 4412
100 Ga0496112_0106477 3300048915 Bacteria 2774
101 Ga0496113_0057297 3300048916 Bacteria 2928
102 Ga0496115_0223287 3300048918 Bacteria 1555
103 Ga0496121_0015586 3300048924 Bacteria 7942
104 Ga0496126_0000003 3300048929 Bacteria 961576
105 Ga0501031_0044825 3300049568 Bacteria 2886
106 Ga0501031_0115796 3300049568 Bacteria 1751
107 Ga0501032_0194761 3300049569 Bacteria 1324
108 Ga0501032_0290565 3300049569 Bacteria 1057
109 Ga0501033_0051386 3300049570 Bacteria 3055
110 Ga0501034_0001763 3300049571 Bacteria 27682
111 Ga0501034_0035410 3300049571 Bacteria 5061
112 Ga0501034_0116967 3300049571 Bacteria 2654
113 Ga0501034_0171521 3300049571 Bacteria 2136
114 Ga0501036_0110974 3300049572 Bacteria 2317
115 Ga0501037_0033331 3300049573 Bacteria 3804
116 Ga0501037_0077998 3300049573 Bacteria 2403
117 Ga0501038_0095992 3300049574 Bacteria 2475
118 Ga0501038_0174047 3300049574 Bacteria 1740
119 Ga0501038_0215276 3300049574 Bacteria 1535
120 Ga0501039_0032885 3300049575 Bacteria 4000
121 Ga0501047_0151432 3300049581 Bacteria 2195
122 Ga0501068_0348464 3300049584 Bacteria 951
123 Ga0501070_0046114 3300049586 Bacteria 3624
124 Ga0501071_0028275 3300049587 Bacteria 3951
125 Ga0501073_0015709 3300049589 Bacteria 5490
126 Ga0501075_0150846 3300049591 Bacteria 1772
127 Ga0501080_0168949 3300049742 Bacteria 2018
128 Ga0501083_0179817 3300049744 Bacteria 1381
129 Ga0501035_0111719 3300049822 Bacteria 2394
130 Ga0501035_0138563 3300049822 Bacteria 2116
131 Ga0501044_0001140 3300049823 Bacteria 31522
132 Ga0501044_0062640 3300049823 Bacteria 3801
133 nmdc:mga0qj67_98736_c1 3300050509 Bacteria 2352
134 nmdc:mga06r32_308925_c1 3300050510 Bacteria 1567
135 nmdc:mga0n895_101671_c1 3300050512 Bacteria 2884
136 nmdc:mga0rr50_569222_c1 3300050513 Bacteria 965
137 Ga0495619_0061456 3300053085 Bacteria 2500
138 Ga0501084_0443721 3300054114 Bacteria 1097
139 Ga0501082_0010342 3300060353 Bacteria 8032
140 Ga0501082_0050286 3300060353 Bacteria 3595
141 Ga0530510_0051722 3300061734 Bacteria 2969
142 Ga0530510_0334861 3300061734 Bacteria 1136
143 8001848949 8001845381 Bacteria 5804942
144 2687236186 2684623219 Bacteria 8442773
145 2919451091 2919450847 Bacteria 5631160
146 2919718071 2919713450 Bacteria 7431245
147 2990268087 2990265787 Bacteria 3943888
148 2993696889 2993693658 Bacteria 4040749
149 Ga0070666_10039174
150 Ga0070680_100004459
151 Ga0070660_100232174
152 Ga0070687_100017831
153 Ga0070675_100106602
154 Ga0070673_100085428
155 Ga0070688_100194460
156 Ga0070667_100065656
157 Ga0070711_100031879
158 Ga0070681_10035305
159 Ga0070685_10015760
160 Ga0070707_100070412
161 Ga0070707_100270212
162 Ga0070698_100024231
163 Ga0070699_100052769
164 Ga0070679_100002402
165 Ga0070665_100112896
166 Ga0070665_100163028
167 Ga0070664_100145667
168 Ga0068857_100014981
169 Ga0068859_100027648
170 Ga0068858_100381692
171 Ga0075365_10104950
172 Ga0070712_100277785
173 Ga0075430_100107002
174 Ga0075431_100378570
175 Ga0075434_100116567
176 Ga0097620_100027646
177 Ga0105242_10010355
178 Ga0105248_10106790
179 Ga0105239_10318889
180 Ga0157375_10232385
181 Ga0157379_10281014
182 Ga0224712_10001689
183 Ga0209676_1019283
184 Ga0207680_10023556
185 Ga0207645_10198929
186 Ga0207660_10094398
187 Ga0207657_10277561
188 Ga0207652_10040371
189 Ga0207650_10018813
190 Ga0207687_10554528
191 Ga0207711_10282535
192 Ga0207679_10256611
193 Ga0207651_10091976
194 Ga0207708_10092755
195 Ga0207641_10326350
196 Ga0207648_10017622
197 Ga0207674_10003965
198 Ga0207698_10101152
199 Ga0268264_10074438
200 Ga0268264_10375817
201 Ga0265336_10005498
202 Ga0265338_10032186
203 Ga0265324_10039140
204 Ga0265320_10004551
205 Ga0265340_10098806
206 Ga0265314_10005976
207 Ga0265342_10000197
208 Ga0373939_0018659
209 Ga0373954_0106907
210 Ga0316574_0111370
211 Ga0373935_0322077
212 Ga0373937_0014641
213 Ga0373937_0034862
214 Ga0373937_0531297
215 Ga0373925_0276410
216 Ga0395899_0000013
217 Ga0436365_1468445
218 Ga0436361_1117852
219 Ga0436362_0950054
220 Ga0451577_0154987
221 Ga0466966_0055080
222 Ga0466963_0028084
223 Ga0466970_0016273
224 Ga0466959_0038877
225 Ga0466967_0056793
226 Ga0466967_0075928
227 Ga0495592_0095604
228 Ga0495603_0074194
229 Ga0495651_0453122
230 Ga0495651_0477773
231 Ga0495582_0013561
232 Ga0495608_0247299
233 Ga0495586_0004081
234 Ga0495598_0004405
235 Ga0495621_0007711
236 Ga0495622_0089315
237 Ga0495658_0061112
238 Ga0495658_0072309
239 Ga0496104_0300293
240 Ga0496108_0003614
241 Ga0496108_0367258
242 Ga0496108_0749784
243 Ga0496109_0001430
244 Ga0496109_0221983
245 Ga0496110_0092159
246 Ga0496110_0559699
247 Ga0496111_0022530
248 Ga0496112_0106477
249 Ga0496113_0057297
250 Ga0496115_0223287
251 Ga0496121_0015586
252 Ga0496126_0000003
253 Ga0501031_0044825
254 Ga0501031_0115796
255 Ga0501032_0194761
256 Ga0501032_0290565
257 Ga0501033_0051386
258 Ga0501034_0001763
259 Ga0501034_0035410
260 Ga0501034_0116967
261 Ga0501034_0171521
262 Ga0501036_0110974
263 Ga0501037_0033331
264 Ga0501037_0077998
265 Ga0501038_0095992
266 Ga0501038_0174047
267 Ga0501038_0215276
268 Ga0501039_0032885
269 Ga0501047_0151432
270 Ga0501068_0348464
271 Ga0501070_0046114
272 Ga0501071_0028275
273 Ga0501073_0015709
274 Ga0501075_0150846
275 Ga0501080_0168949
276 Ga0501083_0179817
277 Ga0501035_0111719
278 Ga0501035_0138563
279 Ga0501044_0001140
280 Ga0501044_0062640
281 nmdc:mga0qj67_98736_c1
282 nmdc:mga06r32_308925_c1
283 nmdc:mga0n895_101671_c1
284 nmdc:mga0rr50_569222_c1
285 Ga0495619_0061456
286 Ga0501084_0443721
287 Ga0501082_0010342
288 Ga0501082_0050286
289 Ga0530510_0051722
290 Ga0530510_0334861
291 8001848949
292 2687236186
293 2919451091
294 2919718071
295 2990268087
296 2993696889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02569

Pantoate_ligase

Pantoate-beta-alanine ligase

34

309

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x3f-assembly1.cif.gz_A crystal structure of the methicillin-resistant staphylococcus aureus sar2676, a pantothenate synthetase. 0.9591 1 274
3ag6-assembly1.cif.gz_B crystal structure of pantothenate synthetase from staphylococcus aureus in complex with pantoyl adenylate 0.9552 1 274
1ufv-assembly1.cif.gz_A crystal structure of pantothenate synthetase from thermus thermophilus hb8 0.9551 1 276
3q10-assembly2.cif.gz_B pantoate-beta-alanine ligase from yersinia pestis 0.9523 1 273
3inn-assembly1.cif.gz_A crystal structure of pantoate-beta-alanine-ligase in complex with atp at low occupancy at 2.1 a resolution 0.952 1 273
ID Description Score Start End Superfamily
3innA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9645 3 176 3.40.50.620
3innA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9485 3 176 3.40.50.620
5kwvA02 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;Pantoate-beta-alanine ligase, C-terminal domain 0.9457 177 274 3.30.1300.10
3uy4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9453 3 176 3.40.50.620
5hg0A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9453 2 176 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A658NLZ5-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9894 127 207 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A258QGD6-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9831 121 276 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A2M7SQ86-F1-model_v4 Pantoate--beta-alanine ligase (EC 6.3.2.1) 0.9823 1 177 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A2M7JJJ6-F1-model_v4 Pantoate--beta-alanine ligase (EC 6.3.2.1) 0.9818 34 198 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A529VHP5-F1-model_v4 deleted 0.9808 27 221

Map