F204532

General Info

Members Datasets Scaffolds Average Seq Length
148 98 296 259

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154129|2515720037
Length 298
Sequence DRVAVITGGAGGIGSALARRFAAEGAAAVVVADLDPTAARAVADTVGPVARPVEVDVTDEEQVHALVTETEQRHGRIDLFCANAGVATGGGEAAPDADWDRAWRVNVLSHVYTARAVLPAMLARGGGHLLMTCSAAGVLTAVGDAPYAATKHAAVAFAEWLAITYRDQGIRVSALCPQGVATPMLTGGLAAGHLAARVVAASGTVLTPDQVADAVITGLAEERFLILPHPEVAEYARRRAEDPDGWQAGLRKLIRRLTGSTVRAGRSAGADPRGPDAAGQGGPATADGATRDGPPAAP

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
37 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
38 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
39 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
40 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
41 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
42 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
43 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
57 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
58 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
59 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
60 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
62 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
63 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
64 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
65 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
66 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
67 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
68 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
69 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
70 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
71 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
72 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
73 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
74 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
75 2855683550 Micromonospora sp. RP3T Isolate Unclassified
76 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
77 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
78 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
79 2858868258 Micromonospora sp. MH33 Isolate Unclassified
80 2858882152 Micromonospora noduli MED15 Isolate Nodule
81 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
82 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
83 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
84 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
85 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
86 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
87 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
88 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
89 2902582711 Micromonospora sp. AP08 Isolate Unclassified
90 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
91 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
92 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
93 649633069 Micromonospora sp. L5 Isolate Unclassified
94 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
95 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
96 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
97 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
98 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.05
Metatranscriptomes 0
Isolates 20.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 2.7
Rhizoplane 3.38
Rhizosphere 79.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100002814 3300005343 Bacteria 6632
2 Ga0070703_10006392 3300005406 Bacteria 3304
3 Ga0070703_10037363 3300005406 Bacteria 1496
4 Ga0070714_100000056 3300005435 Bacteria 103178
5 Ga0070714_100127792 3300005435 Bacteria 2268
6 Ga0070700_100000164 3300005441 Bacteria 38488
7 Ga0070708_100000593 3300005445 Bacteria 27208
8 Ga0070708_100027015 3300005445 Bacteria 4920
9 Ga0070708_100234992 3300005445 Bacteria 1720
10 Ga0070706_100000047 3300005467 Bacteria 143702
11 Ga0070706_100000705 3300005467 Bacteria 37590
12 Ga0070706_100183241 3300005467 Bacteria 1956
13 Ga0070707_100003462 3300005468 Bacteria 14906
14 Ga0070707_100018698 3300005468 Bacteria 6521
15 Ga0070707_100021686 3300005468 Bacteria 6072
16 Ga0070698_100020834 3300005471 Bacteria 6871
17 Ga0070698_100026831 3300005471 Bacteria 5991
18 Ga0070698_100037246 3300005471 Bacteria 5017
19 Ga0070698_100052864 3300005471 Bacteria 4130
20 Ga0070698_100114785 3300005471 Bacteria 2657
21 Ga0070699_100000872 3300005518 Bacteria 28072
22 Ga0070699_100002186 3300005518 Bacteria 17702
23 Ga0070699_100314808 3300005518 Bacteria 1406
24 Ga0070699_100691751 3300005518 Bacteria 931
25 Ga0070697_100011236 3300005536 Bacteria 6998
26 Ga0070697_100011616 3300005536 Bacteria 6883
27 Ga0070697_100162767 3300005536 Bacteria 1885
28 Ga0070704_100105785 3300005549 Bacteria 2131
29 Ga0070664_100211559 3300005564 Bacteria 1733
30 Ga0081539_10000853 3300005985 Bacteria 58307
31 Ga0070717_10000020 3300006028 Bacteria 172640
32 Ga0070717_10256320 3300006028 Bacteria 1547
33 Ga0075428_100016271 3300006844 Bacteria 8222
34 Ga0075428_100272593 3300006844 Bacteria 1821
35 Ga0075430_100002165 3300006846 Bacteria 16256
36 Ga0075431_100127556 3300006847 Bacteria 2625
37 Ga0075431_100139125 3300006847 Bacteria 2503
38 Ga0075434_100034273 3300006871 Bacteria 5013
39 Ga0075434_100281018 3300006871 Bacteria 1684
40 Ga0075434_100447860 3300006871 Bacteria 1312
41 Ga0075434_100603785 3300006871 Bacteria 1116
42 Ga0075429_100024456 3300006880 Bacteria 5240
43 Ga0075429_100091546 3300006880 Bacteria 2652
44 Ga0075436_100057039 3300006914 Bacteria 2697
45 Ga0075436_100077194 3300006914 Bacteria 2307
46 Ga0075436_100245771 3300006914 Bacteria 1273
47 Ga0075435_100053158 3300007076 Bacteria 3265
48 Ga0075435_100155733 3300007076 Bacteria 1922
49 Ga0099794_10000221 3300007265 Bacteria 20441
50 Ga0114129_10003963 3300009147 Bacteria 20906
51 Ga0114129_10465300 3300009147 Bacteria 1657
52 Ga0114129_10741988 3300009147 Bacteria 1258
53 Ga0157370_10066048 3300013104 Bacteria 3422
54 Ga0157372_10000044 3300013307 Bacteria 152637
55 Ga0163163_10013443 3300014325 Bacteria 7497
56 Ga0213875_10008025 3300021388 Bacteria 5424
57 Ga0207653_10003670 3300025885 Bacteria 4828
58 Ga0207653_10011970 3300025885 Bacteria 2705
59 Ga0207699_10361796 3300025906 Bacteria 1026
60 Ga0207684_10000001 3300025910 Bacteria 1115726
61 Ga0207684_10000003 3300025910 Bacteria 766933
62 Ga0207684_10054507 3300025910 Bacteria 3392
63 Ga0207684_10084146 3300025910 Bacteria 2709
64 Ga0207684_10140344 3300025910 Bacteria 2077
65 Ga0207684_10325594 3300025910 Bacteria 1324
66 Ga0207646_10000147 3300025922 Bacteria 96075
67 Ga0207646_10000159 3300025922 Bacteria 91906
68 Ga0207646_10001220 3300025922 Bacteria 32289
69 Ga0207646_10001416 3300025922 Bacteria 29797
70 Ga0207646_10011441 3300025922 Bacteria 8598
71 Ga0207646_10023064 3300025922 Bacteria 5722
72 Ga0207646_10039524 3300025922 Bacteria 4246
73 Ga0207687_10015162 3300025927 Bacteria 5051
74 Ga0207664_10000074 3300025929 Bacteria 102862
75 Ga0207679_10100475 3300025945 Bacteria 2261
76 Ga0207708_10000110 3300026075 Bacteria 62957
77 Ga0307508_10024883 3300031616 Bacteria 5431
78 Ga0316575_10034060 3300031665 Bacteria 2000
79 Ga0316579_10056887 3300031691 Bacteria 1836
80 Ga0316578_10122841 3300031728 Bacteria 1561
81 Ga0316583_10017872 3300032133 Bacteria 2547
82 Ga0316583_10049771 3300032133 Bacteria 1476
83 Ga0316574_0004821 3300035398 Bacteria 7138
84 Ga0316582_0212600 3300036647 Bacteria 1321
85 Ga0395899_0000004 3300037312 Bacteria 874267
86 Ga0395899_0027799 3300037312 Bacteria 4261
87 Ga0395900_0009607 3300037418 Bacteria 9917
88 Ga0395898_0002269 3300037466 Bacteria 23284
89 Ga0395898_0396626 3300037466 Bacteria 1316
90 Ga0395905_0001539 3300037471 Bacteria 27614
91 Ga0436364_1232328 3300037853 Bacteria 5622
92 Ga0395901_0006022 3300038443 Bacteria 12288
93 Ga0453683_0257633 3300044673 Bacteria 1113
94 Ga0466961_0023897 3300044693 Bacteria 3933
95 Ga0466961_0031016 3300044693 Bacteria 3436
96 Ga0466971_0064520 3300044719 Bacteria 1658
97 Ga0466968_0015365 3300044735 Bacteria 3033
98 Ga0466970_0038523 3300044765 Bacteria 2536
99 Ga0466970_0087439 3300044765 Bacteria 1690
100 Ga0466960_0060666 3300044901 Bacteria 1854
101 Ga0466967_0002413 3300045976 Bacteria 11610
102 Ga0466967_0096392 3300045976 Bacteria 2698
103 Ga0496108_0020469 3300048911 Bacteria 5440
104 Ga0496109_0008715 3300048912 Bacteria 8637
105 Ga0496109_0762616 3300048912 Bacteria 905
106 Ga0496110_0052702 3300048913 Bacteria 3575
107 Ga0496112_0158172 3300048915 Bacteria 2232
108 Ga0501032_0005074 3300049569 Bacteria 9835
109 Ga0501069_0088651 3300049585 Bacteria 1749
110 Ga0501035_0530282 3300049822 Bacteria 966
111 nmdc:mga05p37_17423_c1 3300050507 Bacteria 8671
112 nmdc:mga0qj67_69245_c1 3300050509 Bacteria 2814
113 nmdc:mga06r32_216463_c1 3300050510 Bacteria 1903
114 nmdc:mga06r32_272021_c1 3300050510 Bacteria 1681
115 nmdc:mga06r32_58954_c1 3300050510 Bacteria 3691
116 nmdc:mga0n895_233015_c1 3300050512 Bacteria 1869
117 nmdc:mga08x19_61511_c1 3300050514 Bacteria 2434
118 2515720037 2515154129 Bacteria 5584369
119 2515497928 2515154088 Bacteria 5526283
120 2515759677 2515154137 Bacteria 5711575
121 2516084831 2515154202 Bacteria 5471270
122 2516092421 2515154203 Bacteria 5458536
123 2623590533 2622736626 Bacteria 7181580
124 2644029663 2643221603 Bacteria 6147767
125 2855683953 2855683550 Bacteria 7134265
126 2856864148 2856858025 Bacteria 7255264
127 2857293220 2857288857 Bacteria 7189066
128 2858852927 2858848962 Bacteria 6963058
129 2858870631 2858868258 Bacteria 7683772
130 2858883324 2858882152 Bacteria 7230291
131 2858891376 2858888857 Bacteria 7060307
132 2858906492 2858902515 Bacteria 7086037
133 2867302885 2867302475 Bacteria 7087181
134 2867313901 2867312974 Bacteria 7058875
135 2867325842 2867319477 Bacteria 7069771
136 2869071536 2869068681 Bacteria 7205615
137 2880490038 2880489317 Bacteria 7096270
138 2880502522 2880495981 Bacteria 7340502
139 2902582759 2902582711 Bacteria 6187705
140 2929224361 2929219909 Bacteria 6984360
141 2929230955 2929226422 Bacteria 7248583
142 2996225583 2996221748 Bacteria 6799777
143 649814312 649633069 Bacteria 6962533
144 8003833769 8003830390 Bacteria 6541657
145 8003877130 8003870546 Bacteria 7396674
146 8054704983 8054704163 Bacteria 7247792
147 8054733272 8054727385 Bacteria 7558670
148 8054738848 8054734606 Bacteria 6947278
149 Ga0070687_100002814
150 Ga0070703_10006392
151 Ga0070703_10037363
152 Ga0070714_100000056
153 Ga0070714_100127792
154 Ga0070700_100000164
155 Ga0070708_100000593
156 Ga0070708_100027015
157 Ga0070708_100234992
158 Ga0070706_100000047
159 Ga0070706_100000705
160 Ga0070706_100183241
161 Ga0070707_100003462
162 Ga0070707_100018698
163 Ga0070707_100021686
164 Ga0070698_100020834
165 Ga0070698_100026831
166 Ga0070698_100037246
167 Ga0070698_100052864
168 Ga0070698_100114785
169 Ga0070699_100000872
170 Ga0070699_100002186
171 Ga0070699_100314808
172 Ga0070699_100691751
173 Ga0070697_100011236
174 Ga0070697_100011616
175 Ga0070697_100162767
176 Ga0070704_100105785
177 Ga0070664_100211559
178 Ga0081539_10000853
179 Ga0070717_10000020
180 Ga0070717_10256320
181 Ga0075428_100016271
182 Ga0075428_100272593
183 Ga0075430_100002165
184 Ga0075431_100127556
185 Ga0075431_100139125
186 Ga0075434_100034273
187 Ga0075434_100281018
188 Ga0075434_100447860
189 Ga0075434_100603785
190 Ga0075429_100024456
191 Ga0075429_100091546
192 Ga0075436_100057039
193 Ga0075436_100077194
194 Ga0075436_100245771
195 Ga0075435_100053158
196 Ga0075435_100155733
197 Ga0099794_10000221
198 Ga0114129_10003963
199 Ga0114129_10465300
200 Ga0114129_10741988
201 Ga0157370_10066048
202 Ga0157372_10000044
203 Ga0163163_10013443
204 Ga0213875_10008025
205 Ga0207653_10003670
206 Ga0207653_10011970
207 Ga0207699_10361796
208 Ga0207684_10000001
209 Ga0207684_10000003
210 Ga0207684_10054507
211 Ga0207684_10084146
212 Ga0207684_10140344
213 Ga0207684_10325594
214 Ga0207646_10000147
215 Ga0207646_10000159
216 Ga0207646_10001220
217 Ga0207646_10001416
218 Ga0207646_10011441
219 Ga0207646_10023064
220 Ga0207646_10039524
221 Ga0207687_10015162
222 Ga0207664_10000074
223 Ga0207679_10100475
224 Ga0207708_10000110
225 Ga0307508_10024883
226 Ga0316575_10034060
227 Ga0316579_10056887
228 Ga0316578_10122841
229 Ga0316583_10017872
230 Ga0316583_10049771
231 Ga0316574_0004821
232 Ga0316582_0212600
233 Ga0395899_0000004
234 Ga0395899_0027799
235 Ga0395900_0009607
236 Ga0395898_0002269
237 Ga0395898_0396626
238 Ga0395905_0001539
239 Ga0436364_1232328
240 Ga0395901_0006022
241 Ga0453683_0257633
242 Ga0466961_0023897
243 Ga0466961_0031016
244 Ga0466971_0064520
245 Ga0466968_0015365
246 Ga0466970_0038523
247 Ga0466970_0087439
248 Ga0466960_0060666
249 Ga0466967_0002413
250 Ga0466967_0096392
251 Ga0496108_0020469
252 Ga0496109_0008715
253 Ga0496109_0762616
254 Ga0496110_0052702
255 Ga0496112_0158172
256 Ga0501032_0005074
257 Ga0501069_0088651
258 Ga0501035_0530282
259 nmdc:mga05p37_17423_c1
260 nmdc:mga0qj67_69245_c1
261 nmdc:mga06r32_216463_c1
262 nmdc:mga06r32_272021_c1
263 nmdc:mga06r32_58954_c1
264 nmdc:mga0n895_233015_c1
265 nmdc:mga08x19_61511_c1
266 2515720037
267 2515497928
268 2515759677
269 2516084831
270 2516092421
271 2623590533
272 2644029663
273 2855683953
274 2856864148
275 2857293220
276 2858852927
277 2858870631
278 2858883324
279 2858891376
280 2858906492
281 2867302885
282 2867313901
283 2867325842
284 2869071536
285 2880490038
286 2880502522
287 2902582759
288 2929224361
289 2929230955
290 2996225583
291 649814312
292 8003833769
293 8003877130
294 8054704983
295 8054733272
296 8054738848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

2

190

0.94

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

5

90

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

8

224

0.87

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

2

69

0.81

PF08659

KR

KR domain

3

176

0.78

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

205

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
5itv-assembly1.cif.gz_A crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9367 3 231
6zzq-assembly1.cif.gz_A crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and acetoacetate 0.9359 2 213
6zzs-assembly2.cif.gz_F-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate 0.9297 1 213
6zzs-assembly2.cif.gz_E-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate 0.9283 2 224
3gvc-assembly1.cif.gz_A-2 crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis 0.9275 4 224
ID Description Score Start End Superfamily
af_U4PBL3_32_278_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9452 1 223 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9448 87 185 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9447 3 190 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9439 58 173 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9378 7 185 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A535T2D2-F1-model_v4 SDR family oxidoreductase 0.9855 71 252 GO:0016491
AF-A0A1Q7VGV9-F1-model_v4 Dehydrogenase 0.9828 1 246 GO:0016491
AF-A0A3D3W629-F1-model_v4 Short-chain dehydrogenase 0.9807 1 186 GO:0016616
AF-A0A399XRA7-F1-model_v4 Short-chain dehydrogenase 0.9789 1 254 GO:0016491
AF-A0A2T3W5M3-F1-model_v4 Short-chain dehydrogenase 0.9779 1 254 GO:0016491

Map