F204447

General Info

Members Datasets Scaffolds Average Seq Length
148 109 296 294

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_118163_c1|nmdc:mga0n895_118163_c1_568_1539
Length 323
Sequence MVDLCAVNPGRCRGILKDLNNNKMKKQISFSSQGQRADIGEFRIHRMLPNRYADAVGPFVFLDHVLPTKHSPDEPLKIVNGTGAHPHRGIATLTYILNGEADHHDSKGHHAKVRSGGAQWMKAGNGIIHDEVVNVDPETGDLLTHGFQFWINLPAKQKAELPEYLPVEASEVPQQNLDDNKGWIKVIVGQYKDLVSKIPNYSKQFLYHVHLEAGKQFSITTENGMEYAAFLPLHDAMINDTEFSKGEFIEFDRNEGTIEISNNDDAAIDIILFGGEKYAEPIVAQGPFVMNTQAEIAQAYRDFYEGKYGKIDYSRNSQKTKQF

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
65 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
66 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
75 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
76 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
77 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
78 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
79 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
80 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
81 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
84 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
85 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
86 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
87 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
88 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
89 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
90 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
91 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
92 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
93 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
94 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
95 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
96 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
97 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
98 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
99 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
100 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
101 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
102 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
103 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
104 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
105 2738541278 Niastella sp. CF465 Isolate Unclassified
106 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
107 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
108 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
109 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 0
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.19
Nodule 0
Rhizoplane 0
Rhizosphere 77.03
Stem 0
Stem Tuber 0
Unclassified 6.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_118163_c1 3300050512 Bacteria 2671
2 MBSR1b_contig_1833037 2162886012 Bacteria 3815
3 JGI24740J21852_10000112 3300001979 Bacteria 29500
4 JGI25154J39366_1000001 3300002738 Bacteria 483450
5 JGI25157J39369_1003361 3300002741 Bacteria 3305
6 JGI25153J46596_10015195 3300003215 Bacteria 3152
7 rootH2_10100371 3300003320 Bacteria 4920
8 JGI25160J50197_1007355 3300003354 Bacteria 4323
9 Ga0065165_1000771 3300005262 Bacteria 43216
10 Ga0065712_10003736 3300005290 Bacteria 3806
11 Ga0065715_10093361 3300005293 Bacteria 4713
12 Ga0070683_100243669 3300005329 Bacteria 1710
13 Ga0070683_100359760 3300005329 Bacteria 1386
14 Ga0070690_100077273 3300005330 Bacteria 2173
15 Ga0070670_100034798 3300005331 Bacteria 4335
16 Ga0070670_100121604 3300005331 Bacteria 2252
17 Ga0070670_100253372 3300005331 Bacteria 1534
18 Ga0070666_10039596 3300005335 Bacteria 3142
19 Ga0070689_100038501 3300005340 Bacteria 3659
20 Ga0070671_100201053 3300005355 Bacteria 1689
21 Ga0070673_100107410 3300005364 Bacteria 2309
22 Ga0070688_100039512 3300005365 Bacteria 2887
23 Ga0070667_100007252 3300005367 Bacteria 9211
24 Ga0070667_100027492 3300005367 Bacteria 4733
25 Ga0068867_100025471 3300005459 Bacteria 4245
26 Ga0068867_100194022 3300005459 Bacteria 1622
27 Ga0070698_100108853 3300005471 Unclassified 2738
28 Ga0070684_100094401 3300005535 Bacteria 2664
29 Ga0070664_100024127 3300005564 Bacteria 5028
30 Ga0070664_100256987 3300005564 Bacteria 1571
31 Ga0070702_100309401 3300005615 Bacteria 1096
32 Ga0068859_100050717 3300005617 Bacteria 4169
33 Ga0068859_100158074 3300005617 Bacteria 2345
34 Ga0068864_100037355 3300005618 Bacteria 4145
35 Ga0068863_100231913 3300005841 Bacteria 1781
36 Ga0068860_100068322 3300005843 Bacteria 3376
37 Ga0068862_100250588 3300005844 Bacteria 1614
38 Ga0097621_100000281 3300006237 Bacteria 34161
39 Ga0097621_100054358 3300006237 Bacteria 3265
40 Ga0068871_100013224 3300006358 Bacteria 6121
41 Ga0068871_100133438 3300006358 Bacteria 2107
42 Ga0075434_100120659 3300006871 Bacteria 2637
43 Ga0097620_100050716 3300006931 Bacteria 4169
44 Ga0097620_100158071 3300006931 Bacteria 2345
45 Ga0105249_10132204 3300009553 Bacteria 2383
46 Ga0105239_10129444 3300010375 Bacteria 2806
47 Ga0105239_10228041 3300010375 Bacteria 2090
48 Ga0157374_10000455 3300013296 Bacteria 37317
49 Ga0157378_10010439 3300013297 Bacteria 8111
50 Ga0157378_10034572 3300013297 Bacteria 4469
51 Ga0157378_10203557 3300013297 Unclassified 1873
52 Ga0157378_10470502 3300013297 Bacteria 1250
53 Ga0163162_10000881 3300013306 Bacteria 27899
54 Ga0163162_10054315 3300013306 Unclassified 4029
55 Ga0163162_10094896 3300013306 Bacteria 3069
56 Ga0163162_10105825 3300013306 Bacteria 2907
57 Ga0157375_10000695 3300013308 Bacteria 29734
58 Ga0157375_10031415 3300013308 Bacteria 5021
59 Ga0157375_10069689 3300013308 Bacteria 3524
60 Ga0157375_10075661 3300013308 Unclassified 3392
61 Ga0157375_10181356 3300013308 Bacteria 2257
62 Ga0163163_10000075 3300014325 Bacteria 109545
63 Ga0163163_10219122 3300014325 Bacteria 1952
64 Ga0163163_10317147 3300014325 Bacteria 1612
65 Ga0157380_10000225 3300014326 Bacteria 33750
66 Ga0157380_10257067 3300014326 Bacteria 1584
67 Ga0157377_10089894 3300014745 Bacteria 1811
68 Ga0157377_10134058 3300014745 Bacteria 1516
69 Ga0157379_10049159 3300014968 Bacteria 3765
70 Ga0157379_10116321 3300014968 Bacteria 2405
71 Ga0157379_10184384 3300014968 Bacteria 1885
72 Ga0157379_10479067 3300014968 Bacteria 1151
73 Ga0157376_10021090 3300014969 Bacteria 5056
74 Ga0163161_10019190 3300017792 Bacteria 4795
75 Ga0163161_10039887 3300017792 Bacteria 3372
76 Ga0209646_1000002 3300025246 Bacteria 1425781
77 Ga0209026_1000450 3300025250 Bacteria 32815
78 Ga0207426_1000444 3300025302 Bacteria 66461
79 Ga0207680_10041524 3300025903 Bacteria 2684
80 Ga0207645_10056487 3300025907 Bacteria 2506
81 Ga0207650_10042996 3300025925 Bacteria 3315
82 Ga0207650_10204798 3300025925 Bacteria 1582
83 Ga0207650_10283432 3300025925 Bacteria 1350
84 Ga0207686_10132181 3300025934 Bacteria 1713
85 Ga0207670_10006016 3300025936 Bacteria 6705
86 Ga0207689_10474469 3300025942 Bacteria 1047
87 Ga0207661_10229564 3300025944 Bacteria 1643
88 Ga0207679_10002942 3300025945 Bacteria 10549
89 Ga0207712_10042379 3300025961 Bacteria 3133
90 Ga0207712_10087847 3300025961 Bacteria 2281
91 Ga0207677_10513777 3300026023 Bacteria 1038
92 Ga0207641_10218030 3300026088 Bacteria 1768
93 Ga0207648_10025702 3300026089 Bacteria 5242
94 Ga0207676_10041889 3300026095 Bacteria 3519
95 Ga0207676_10047368 3300026095 Bacteria 3331
96 Ga0207676_10053970 3300026095 Bacteria 3148
97 Ga0207676_10708002 3300026095 Unclassified 976
98 Ga0268265_10094312 3300028380 Bacteria 2400
99 Ga0316177_1191606 3300030731 Bacteria 7138
100 Ga0316176_1041537 3300030732 Bacteria 16130
101 Ga0316183_1163695 3300030742 Bacteria 7181
102 Ga0307513_10079653 3300031456 Bacteria 3383
103 Ga0307509_10090024 3300031507 Bacteria 3145
104 Ga0307407_10000142 3300031903 Bacteria 22164
105 Ga0307416_100000007 3300032002 Bacteria 433284
106 Ga0307414_10003277 3300032004 Bacteria 8634
107 Ga0307414_10074790 3300032004 Bacteria 2456
108 Ga0307414_10261680 3300032004 Unclassified 1444
109 Ga0373935_0136372 3300035692 Bacteria 1654
110 Ga0395905_0377498 3300037471 Unclassified 1311
111 Ga0439447_003525 3300041407 Bacteria 5552
112 Ga0439433_0002093 3300041999 Bacteria 4203
113 Ga0439449_0030673 3300042007 Bacteria 2004
114 Ga0439457_002466 3300042014 Bacteria 5276
115 Ga0439457_006120 3300042014 Bacteria 2970
116 Ga0439462_0014495 3300042015 Bacteria 2027
117 Ga0495605_0101649 3300046474 Bacteria 1321
118 Ga0495609_0006486 3300046538 Bacteria 5965
119 Ga0495611_0000081 3300046648 Bacteria 67738
120 Ga0495625_0001747 3300046660 Bacteria 25139
121 Ga0495672_0217134 3300047320 Unclassified 946
122 Ga0495678_010924 3300049459 Bacteria 4375
123 Ga0501225_0002105 3300049705 Bacteria 6185
124 Ga0501241_000005 3300049758 Bacteria 176449
125 Ga0501266_010795 3300049763 Unclassified 1166
126 Ga0500578_0000178 3300053086 Bacteria 76527
127 Ga0500646_0002074 3300053090 Bacteria 5228
128 Ga0500641_0000214 3300053096 Bacteria 21862
129 Ga0500562_000100 3300053108 Bacteria 33338
130 Ga0500569_000078 3300053109 Bacteria 16095
131 Ga0500618_004235 3300053125 Bacteria 4654
132 Ga0500652_008231 3300053131 Bacteria 3465
133 Ga0500658_0004024 3300053134 Bacteria 5522
134 Ga0500577_0008431 3300053142 Bacteria 2938
135 Ga0500588_0020209 3300053146 Bacteria 1782
136 Ga0500604_0000796 3300053151 Bacteria 8714
137 Ga0500616_0019606 3300053153 Bacteria 3810
138 Ga0500616_0087182 3300053153 Bacteria 1555
139 Ga0500622_0000224 3300053156 Bacteria 58882
140 Ga0500634_0025373 3300053161 Bacteria 3227
141 Ga0500645_013482 3300053730 Bacteria 2623
142 Ga0500661_010247 3300055283 Bacteria 1708
143 2644686032 2643221725 Bacteria 5087956
144 2738731554 2738541278 Bacteria 9755573
145 2842904576 2842903701 Bacteria 6986368
146 2919686618 2919683626 Bacteria 5534354
147 2929155526 2929154850 Bacteria 6753285
148 2929922734 2929921140 Bacteria 8649150
149 nmdc:mga0n895_118163_c1
150 MBSR1b_contig_1833037
151 JGI24740J21852_10000112
152 JGI25154J39366_1000001
153 JGI25157J39369_1003361
154 JGI25153J46596_10015195
155 rootH2_10100371
156 JGI25160J50197_1007355
157 Ga0065165_1000771
158 Ga0065712_10003736
159 Ga0065715_10093361
160 Ga0070683_100243669
161 Ga0070683_100359760
162 Ga0070690_100077273
163 Ga0070670_100034798
164 Ga0070670_100121604
165 Ga0070670_100253372
166 Ga0070666_10039596
167 Ga0070689_100038501
168 Ga0070671_100201053
169 Ga0070673_100107410
170 Ga0070688_100039512
171 Ga0070667_100007252
172 Ga0070667_100027492
173 Ga0068867_100025471
174 Ga0068867_100194022
175 Ga0070698_100108853
176 Ga0070684_100094401
177 Ga0070664_100024127
178 Ga0070664_100256987
179 Ga0070702_100309401
180 Ga0068859_100050717
181 Ga0068859_100158074
182 Ga0068864_100037355
183 Ga0068863_100231913
184 Ga0068860_100068322
185 Ga0068862_100250588
186 Ga0097621_100000281
187 Ga0097621_100054358
188 Ga0068871_100013224
189 Ga0068871_100133438
190 Ga0075434_100120659
191 Ga0097620_100050716
192 Ga0097620_100158071
193 Ga0105249_10132204
194 Ga0105239_10129444
195 Ga0105239_10228041
196 Ga0157374_10000455
197 Ga0157378_10010439
198 Ga0157378_10034572
199 Ga0157378_10203557
200 Ga0157378_10470502
201 Ga0163162_10000881
202 Ga0163162_10054315
203 Ga0163162_10094896
204 Ga0163162_10105825
205 Ga0157375_10000695
206 Ga0157375_10031415
207 Ga0157375_10069689
208 Ga0157375_10075661
209 Ga0157375_10181356
210 Ga0163163_10000075
211 Ga0163163_10219122
212 Ga0163163_10317147
213 Ga0157380_10000225
214 Ga0157380_10257067
215 Ga0157377_10089894
216 Ga0157377_10134058
217 Ga0157379_10049159
218 Ga0157379_10116321
219 Ga0157379_10184384
220 Ga0157379_10479067
221 Ga0157376_10021090
222 Ga0163161_10019190
223 Ga0163161_10039887
224 Ga0209646_1000002
225 Ga0209026_1000450
226 Ga0207426_1000444
227 Ga0207680_10041524
228 Ga0207645_10056487
229 Ga0207650_10042996
230 Ga0207650_10204798
231 Ga0207650_10283432
232 Ga0207686_10132181
233 Ga0207670_10006016
234 Ga0207689_10474469
235 Ga0207661_10229564
236 Ga0207679_10002942
237 Ga0207712_10042379
238 Ga0207712_10087847
239 Ga0207677_10513777
240 Ga0207641_10218030
241 Ga0207648_10025702
242 Ga0207676_10041889
243 Ga0207676_10047368
244 Ga0207676_10053970
245 Ga0207676_10708002
246 Ga0268265_10094312
247 Ga0316177_1191606
248 Ga0316176_1041537
249 Ga0316183_1163695
250 Ga0307513_10079653
251 Ga0307509_10090024
252 Ga0307407_10000142
253 Ga0307416_100000007
254 Ga0307414_10003277
255 Ga0307414_10074790
256 Ga0307414_10261680
257 Ga0373935_0136372
258 Ga0395905_0377498
259 Ga0439447_003525
260 Ga0439433_0002093
261 Ga0439449_0030673
262 Ga0439457_002466
263 Ga0439457_006120
264 Ga0439462_0014495
265 Ga0495605_0101649
266 Ga0495609_0006486
267 Ga0495611_0000081
268 Ga0495625_0001747
269 Ga0495672_0217134
270 Ga0495678_010924
271 Ga0501225_0002105
272 Ga0501241_000005
273 Ga0501266_010795
274 Ga0500578_0000178
275 Ga0500646_0002074
276 Ga0500641_0000214
277 Ga0500562_000100
278 Ga0500569_000078
279 Ga0500618_004235
280 Ga0500652_008231
281 Ga0500658_0004024
282 Ga0500577_0008431
283 Ga0500588_0020209
284 Ga0500604_0000796
285 Ga0500616_0019606
286 Ga0500616_0087182
287 Ga0500622_0000224
288 Ga0500634_0025373
289 Ga0500645_013482
290 Ga0500661_010247
291 2644686032
292 2738731554
293 2842904576
294 2919686618
295 2929155526
296 2929922734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05726

Pirin_C

Pirin C-terminal cupin domain

206

309

0.94

PF02678

Pirin

Pirin

41

151

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tfq-assembly1.cif.gz_A crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis 0.9234 1 280
6d0g-assembly1.cif.gz_A 1.78 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.9101 7 289
7tfq-assembly1.cif.gz_A crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis 0.9078 1 280
6d0p-assembly4.cif.gz_D 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.9006 1 285
6d0p-assembly4.cif.gz_D 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.8886 1 285
ID Description Score Start End Superfamily
af_C0P2Q1_61_325_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9171 12 282 2.60.120.10
af_C0P2Q1_61_325_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8975 12 282 2.60.120.10
af_Q5AA21_12_289_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8957 12 278 2.60.120.10
af_Q5M827_137_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8781 145 277 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8738 35 127 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1M7Q2I6-F1-model_v4 Pirin C-terminal cupin domain-containing protein 0.9964 145 286
AF-A0A1Q6A279-F1-model_v4 Pirin-like protein 0.9927 56 286 GO:0046872
AF-A0A4R6STK3-F1-model_v4 Pirin family protein 0.9895 1 285 GO:0046872
AF-A0A537JXN1-F1-model_v4 Pirin family protein 0.9865 174 289
AF-A0A3N0VY96-F1-model_v4 Pirin family protein 0.9808 1 288 GO:0046872

Map