F203983

General Info

Members Datasets Scaffolds Average Seq Length
148 111 296 320

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0091626|Ga0466961_0091626_556_1557
Length 333
Sequence MTHEVVEGGRTMKAAVYYQTGSPGVFRYEDVPDPQSAPGEIHIAIEAISIEGGDTLNRLGGELTSSPHIVGYQAAGTVIDVGDGVEAFAPGDRVVTVGLNGSHAEQRVVGQNFAWQIPSGLSINDAACIPIPFGTAYDCLFEFGRLEPGEAALIHAGAGGVGIAAIQLAKQAGARVLATASSDDRLVRLKPLGLDEGINYATHDFVAECRRLTDGRGADVIVDSVGGTNLQRSLAALAYRGRCITVGDASRAVAESLDISGLRGNNQSLTGVFLGGELFMGTRAHAMIADQIDAVASGRLKVVIDRTFPLADAAEAHRYIESRKAFGRVLLIP

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
39 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
40 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
41 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
42 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
43 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
47 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
53 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
54 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
55 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
56 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
57 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
58 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
59 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
60 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
61 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
62 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
63 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
64 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
65 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
66 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
69 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
70 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
71 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
72 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
73 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
74 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
80 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
81 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
82 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
103 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
104 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
105 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
108 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
109 2818991467 Bosea vestrisii 3192 Isolate Unclassified
110 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
111 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 0.68
Isolates 2.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.73
Nodule 0
Rhizoplane 3.38
Rhizosphere 87.84
Stem 0
Stem Tuber 0
Unclassified 3.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0091626 3300044693 Bacteria 1919
2 Ga0070658_10000137 3300005327 Bacteria 64236
3 Ga0070658_10073818 3300005327 Bacteria 2798
4 Ga0070714_100005365 3300005435 Bacteria 9784
5 Ga0070714_100104254 3300005435 Bacteria 2502
6 Ga0070714_100384000 3300005435 Unclassified 1324
7 Ga0070714_100393528 3300005435 Bacteria 1308
8 Ga0070711_100237073 3300005439 Bacteria 1425
9 Ga0070694_100108339 3300005444 Bacteria 1975
10 Ga0070708_100023833 3300005445 Bacteria 5208
11 Ga0070706_100037022 3300005467 Bacteria 4507
12 Ga0070698_100108979 3300005471 Bacteria 2736
13 Ga0070699_100040092 3300005518 Bacteria 4056
14 Ga0070697_100024966 3300005536 Bacteria 4763
15 Ga0070686_100295792 3300005544 Bacteria 1199
16 Ga0070695_100011323 3300005545 Bacteria 5336
17 Ga0070665_100374333 3300005548 Bacteria 1431
18 Ga0081455_10106788 3300005937 Bacteria 2233
19 Ga0075364_10017197 3300006051 Bacteria 4513
20 Ga0075428_100027867 3300006844 Bacteria 6250
21 Ga0075428_100137668 3300006844 Bacteria 2654
22 Ga0075428_100344289 3300006844 Bacteria 1600
23 Ga0075431_100038710 3300006847 Bacteria 4911
24 Ga0075431_100208622 3300006847 Bacteria 1996
25 Ga0075433_10002256 3300006852 Bacteria 14644
26 Ga0075434_100002218 3300006871 Bacteria 16951
27 Ga0075429_100007376 3300006880 Bacteria 9544
28 Ga0075436_100004232 3300006914 Bacteria 9847
29 Ga0075435_100001165 3300007076 Bacteria 16799
30 Ga0157369_10012206 3300013105 Bacteria 9753
31 Ga0163162_10312022 3300013306 Bacteria 1705
32 Ga0157375_10588215 3300013308 Bacteria 1273
33 Ga0206353_10667183 3300020082 Bacteria 1845
34 Ga0213876_10004019 3300021384 Bacteria 8274
35 Ga0207705_10002076 3300025909 Bacteria 15572
36 Ga0207652_10029934 3300025921 Bacteria 4557
37 Ga0207687_10078720 3300025927 Bacteria 2374
38 Ga0207700_10081457 3300025928 Unclassified 2527
39 Ga0207664_10001569 3300025929 Bacteria 14994
40 Ga0207664_10058333 3300025929 Bacteria 3070
41 Ga0207664_10377170 3300025929 Unclassified 1258
42 Ga0207658_10517345 3300025986 Bacteria 1065
43 Ga0207683_10080982 3300026121 Bacteria 2881
44 Ga0268266_10211280 3300028379 Bacteria 1780
45 Ga0265338_10121317 3300028800 Bacteria 2083
46 Ga0265327_10001818 3300031251 Bacteria 24972
47 Ga0265327_10008286 3300031251 Bacteria 7782
48 Ga0373934_0004849 3300035086 Bacteria 4980
49 Ga0373956_0006528 3300035119 Bacteria 4673
50 Ga0373943_0035772 3300035170 Bacteria 2376
51 Ga0373955_0163388 3300035172 Bacteria 1315
52 Ga0373924_0029620 3300035410 Bacteria 2189
53 Ga0373933_0020633 3300035724 Bacteria 3736
54 Ga0436365_0753577 3300039437 Bacteria 16246
55 Ga0466966_0023980 3300044684 Bacteria 3993
56 Ga0466966_0084451 3300044684 Bacteria 1975
57 Ga0466961_0002240 3300044693 Bacteria 12028
58 Ga0466961_0003906 3300044693 Bacteria 9319
59 Ga0466963_0079680 3300044694 Bacteria 2216
60 Ga0466963_0184799 3300044694 Bacteria 1456
61 Ga0466971_0040414 3300044719 Bacteria 2095
62 Ga0466957_0021879 3300044842 Bacteria 3770
63 Ga0466959_0206635 3300045049 Bacteria 1366
64 Ga0466958_0003854 3300045836 Bacteria 7843
65 Ga0466958_0028703 3300045836 Bacteria 3300
66 Ga0466967_0002299 3300045976 Bacteria 11800
67 Ga0466967_0037094 3300045976 Bacteria 4168
68 Ga0495592_0224162 3300046454 Bacteria 1255
69 Ga0495641_0032518 3300046461 Bacteria 2482
70 Ga0495651_0007848 3300046462 Bacteria 8176
71 Ga0495651_0022224 3300046462 Bacteria 4931
72 Ga0495653_0014175 3300046463 Bacteria 6498
73 Ga0495608_0042902 3300046511 Bacteria 3024
74 Ga0495608_0152990 3300046511 Bacteria 1469
75 Ga0495630_0014771 3300046517 Bacteria 5694
76 Ga0495666_0048167 3300046526 Bacteria 2053
77 Ga0495652_0230389 3300046529 Unclassified 1386
78 Ga0495586_0069147 3300046535 Bacteria 1927
79 Ga0495587_0104828 3300046536 Bacteria 1627
80 Ga0495667_0007834 3300046559 Bacteria 7237
81 Ga0495635_0004970 3300046663 Bacteria 9261
82 Ga0495657_0006628 3300046675 Bacteria 9045
83 Ga0495657_0072274 3300046675 Bacteria 2250
84 Ga0495657_0107832 3300046675 Bacteria 1767
85 Ga0495623_0085670 3300046679 Bacteria 1943
86 Ga0495658_0191598 3300046683 Bacteria 1271
87 Ga0495613_0000611 3300046689 Bacteria 28487
88 Ga0495613_0154646 3300046689 Bacteria 1634
89 Ga0495600_0037509 3300046809 Bacteria 3151
90 Ga0495600_0046744 3300046809 Bacteria 2823
91 Ga0495581_0173276 3300047315 Bacteria 1262
92 Ga0495604_0179134 3300047317 Bacteria 1484
93 Ga0495674_0043404 3300047319 Bacteria 4002
94 Ga0495680_0004913 3300047322 Bacteria 12660
95 Ga0495680_0023965 3300047322 Bacteria 5069
96 Ga0495684_0016344 3300047471 Bacteria 5713
97 Ga0495602_0055923 3300048088 Bacteria 3473
98 Ga0495602_0075941 3300048088 Bacteria 2850
99 Ga0496102_0458045 3300048905 Bacteria 1196
100 Ga0496104_0053060 3300048907 Bacteria 3830
101 Ga0496110_0281781 3300048913 Bacteria 1513
102 Ga0496112_0005845 3300048915 Bacteria 10713
103 Ga0496114_0198979 3300048917 Bacteria 1755
104 Ga0496117_0025415 3300048920 Bacteria 4658
105 Ga0501068_0002710 3300049584 Bacteria 9397
106 Ga0501069_0004171 3300049585 Bacteria 7468
107 Ga0501069_0036231 3300049585 Bacteria 2720
108 Ga0501070_0000207 3300049586 Bacteria 55429
109 Ga0501070_0001644 3300049586 Bacteria 19808
110 Ga0501070_0003591 3300049586 Bacteria 13409
111 Ga0501070_0055241 3300049586 Bacteria 3291
112 Ga0501071_0077306 3300049587 Bacteria 2431
113 Ga0501072_0042482 3300049588 Bacteria 3571
114 Ga0501073_0001820 3300049589 Bacteria 15854
115 Ga0501074_0078642 3300049590 Bacteria 2367
116 Ga0501079_0069661 3300049741 Bacteria 2715
117 Ga0501080_0015196 3300049742 Bacteria 7094
118 Ga0501080_0019878 3300049742 Bacteria 6219
119 Ga0501080_0023424 3300049742 Bacteria 5721
120 Ga0501080_0029007 3300049742 Bacteria 5151
121 Ga0501080_0063189 3300049742 Unclassified 3446
122 Ga0501080_0109711 3300049742 Bacteria 2558
123 Ga0501083_0000680 3300049744 Bacteria 22138
124 Ga0501044_0031172 3300049823 Bacteria 5613
125 nmdc:mga00v17_103313_c1 3300050491 Bacteria 1801
126 nmdc:mga00v17_20903_c1 3300050491 Bacteria 3756
127 nmdc:mga06z11_228348_c1 3300050494 Bacteria 1090
128 nmdc:mga05p37_542608_c1 3300050507 Bacteria 1325
129 nmdc:mga05p37_82849_c1 3300050507 Bacteria 3953
130 nmdc:mga09592_52636_c1 3300050508 Bacteria 3436
131 nmdc:mga09592_668949_c1 3300050508 Bacteria 885
132 nmdc:mga0qj67_46295_c1 3300050509 Bacteria 3434
133 nmdc:mga06r32_11761_c1 3300050510 Bacteria 7880
134 nmdc:mga0n895_110597_c1 3300050512 Bacteria 2764
135 nmdc:mga0rr50_85149_c1 3300050513 Bacteria 2449
136 nmdc:mga08x19_111793_c1 3300050514 Bacteria 1823
137 nmdc:mga0a205_32300_c1 3300050515 Bacteria 5020
138 nmdc:mga0sz30_36980_c1 3300050516 Bacteria 2042
139 Ga0495595_0059603 3300053084 Bacteria 1785
140 Ga0500556_0000056 3300053104 Bacteria 115367
141 Ga0500568_0000837 3300053139 Bacteria 21619
142 Ga0501084_0001151 3300054114 Bacteria 20599
143 Ga0501084_0174883 3300054114 Bacteria 1812
144 Ga0501082_0081627 3300060353 Bacteria 2790
145 2758638181 2758568016 Bacteria 5645291
146 2819717569 2818991467 Bacteria 5893227
147 2919682346 2919679072 Bacteria 4629602
148 8001846479 8001845381 Bacteria 5804942
149 Ga0466961_0091626
150 Ga0070658_10000137
151 Ga0070658_10073818
152 Ga0070714_100005365
153 Ga0070714_100104254
154 Ga0070714_100384000
155 Ga0070714_100393528
156 Ga0070711_100237073
157 Ga0070694_100108339
158 Ga0070708_100023833
159 Ga0070706_100037022
160 Ga0070698_100108979
161 Ga0070699_100040092
162 Ga0070697_100024966
163 Ga0070686_100295792
164 Ga0070695_100011323
165 Ga0070665_100374333
166 Ga0081455_10106788
167 Ga0075364_10017197
168 Ga0075428_100027867
169 Ga0075428_100137668
170 Ga0075428_100344289
171 Ga0075431_100038710
172 Ga0075431_100208622
173 Ga0075433_10002256
174 Ga0075434_100002218
175 Ga0075429_100007376
176 Ga0075436_100004232
177 Ga0075435_100001165
178 Ga0157369_10012206
179 Ga0163162_10312022
180 Ga0157375_10588215
181 Ga0206353_10667183
182 Ga0213876_10004019
183 Ga0207705_10002076
184 Ga0207652_10029934
185 Ga0207687_10078720
186 Ga0207700_10081457
187 Ga0207664_10001569
188 Ga0207664_10058333
189 Ga0207664_10377170
190 Ga0207658_10517345
191 Ga0207683_10080982
192 Ga0268266_10211280
193 Ga0265338_10121317
194 Ga0265327_10001818
195 Ga0265327_10008286
196 Ga0373934_0004849
197 Ga0373956_0006528
198 Ga0373943_0035772
199 Ga0373955_0163388
200 Ga0373924_0029620
201 Ga0373933_0020633
202 Ga0436365_0753577
203 Ga0466966_0023980
204 Ga0466966_0084451
205 Ga0466961_0002240
206 Ga0466961_0003906
207 Ga0466963_0079680
208 Ga0466963_0184799
209 Ga0466971_0040414
210 Ga0466957_0021879
211 Ga0466959_0206635
212 Ga0466958_0003854
213 Ga0466958_0028703
214 Ga0466967_0002299
215 Ga0466967_0037094
216 Ga0495592_0224162
217 Ga0495641_0032518
218 Ga0495651_0007848
219 Ga0495651_0022224
220 Ga0495653_0014175
221 Ga0495608_0042902
222 Ga0495608_0152990
223 Ga0495630_0014771
224 Ga0495666_0048167
225 Ga0495652_0230389
226 Ga0495586_0069147
227 Ga0495587_0104828
228 Ga0495667_0007834
229 Ga0495635_0004970
230 Ga0495657_0006628
231 Ga0495657_0072274
232 Ga0495657_0107832
233 Ga0495623_0085670
234 Ga0495658_0191598
235 Ga0495613_0000611
236 Ga0495613_0154646
237 Ga0495600_0037509
238 Ga0495600_0046744
239 Ga0495581_0173276
240 Ga0495604_0179134
241 Ga0495674_0043404
242 Ga0495680_0004913
243 Ga0495680_0023965
244 Ga0495684_0016344
245 Ga0495602_0055923
246 Ga0495602_0075941
247 Ga0496102_0458045
248 Ga0496104_0053060
249 Ga0496110_0281781
250 Ga0496112_0005845
251 Ga0496114_0198979
252 Ga0496117_0025415
253 Ga0501068_0002710
254 Ga0501069_0004171
255 Ga0501069_0036231
256 Ga0501070_0000207
257 Ga0501070_0001644
258 Ga0501070_0003591
259 Ga0501070_0055241
260 Ga0501071_0077306
261 Ga0501072_0042482
262 Ga0501073_0001820
263 Ga0501074_0078642
264 Ga0501079_0069661
265 Ga0501080_0015196
266 Ga0501080_0019878
267 Ga0501080_0023424
268 Ga0501080_0029007
269 Ga0501080_0063189
270 Ga0501080_0109711
271 Ga0501083_0000680
272 Ga0501044_0031172
273 nmdc:mga00v17_103313_c1
274 nmdc:mga00v17_20903_c1
275 nmdc:mga06z11_228348_c1
276 nmdc:mga05p37_542608_c1
277 nmdc:mga05p37_82849_c1
278 nmdc:mga09592_52636_c1
279 nmdc:mga09592_668949_c1
280 nmdc:mga0qj67_46295_c1
281 nmdc:mga06r32_11761_c1
282 nmdc:mga0n895_110597_c1
283 nmdc:mga0rr50_85149_c1
284 nmdc:mga08x19_111793_c1
285 nmdc:mga0a205_32300_c1
286 nmdc:mga0sz30_36980_c1
287 Ga0495595_0059603
288 Ga0500556_0000056
289 Ga0500568_0000837
290 Ga0501084_0001151
291 Ga0501084_0174883
292 Ga0501082_0081627
293 2758638181
294 2819717569
295 2919682346
296 8001846479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

160

296

0.92

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

37

119

0.85

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

192

331

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jyl-assembly1.cif.gz_A crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase 0.9461 2 322
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.9445 1 322
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.9417 1 322
3jyl-assembly1.cif.gz_A crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase 0.9404 2 322
4rvu-assembly2.cif.gz_B the native structure of mycobacterial rv1454c complexed with nadph 0.9387 1 322
ID Description Score Start End Superfamily
af_O74489_1_324_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9519 2 321 3.40.50.300
af_Q8MNM6_143_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9474 128 258 3.40.50.720
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9473 123 261 3.40.50.720
af_Q0J0N7_12_137_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9465 1 119 3.90.180.10
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 125 261 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1G4WBI7-F1-model_v4 NADPH:quinone reductase 0.9805 1 322 GO:0016491
AF-A0A1G4WBI7-F1-model_v4 NADPH:quinone reductase 0.9745 1 322 GO:0016491
AF-A0A7X1FZ00-F1-model_v4 Zinc-binding alcohol dehydrogenase family protein 0.9676 1 322 GO:0016491
AF-A0A2V6WRS4-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9658 1 322 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A3L7X112-F1-model_v4 Quinone oxidoreductase 0.9648 1 180 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402

Map