F203596

General Info

Members Datasets Scaffolds Average Seq Length
148 44 296 187

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10035867|Ga0265316_100358673
Length 213
Sequence VVSDRVGSPPASPAADHRGRVWEPSQGSHNNRTEIRVGGLGGQGIILCGSIIGKAAAIYSGRHAALIQAFGPEARGSACSAQVIVADAAIGYPYVRHPDILVLLSQDAFVQFSPQLKPDGLVLYENELVHPEGKLPTTARSLGIPATRFAEELGRRLVLNIVMAGFFTGATNLLSIDAVEKAVVDSVPKGTESLNLKALMKGYEYGRGLVTPT

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
3 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
4 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
5 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
6 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
7 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
8 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
9 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
10 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
11 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
12 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
13 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
14 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
15 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
16 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
17 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
18 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
19 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
20 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
21 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
22 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
23 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
24 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
25 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
26 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
27 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
28 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
29 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
30 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
33 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
34 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
35 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
36 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
37 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
38 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
39 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
40 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
41 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
42 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
43 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
44 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 1.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 10.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10035867 3300031344 Bacteria 4014
2 Ga0265337_1004753 3300028556 Bacteria 5569
3 Ga0265326_10031540 3300028558 Bacteria 1510
4 Ga0265318_10088579 3300028577 Unclassified 1140
5 Ga0265318_10171763 3300028577 Unclassified 794
6 Ga0265323_10000907 3300028653 Bacteria 15672
7 Ga0265323_10003281 3300028653 Bacteria 7196
8 Ga0265323_10003633 3300028653 Bacteria 6772
9 Ga0265323_10025042 3300028653 Bacteria 2264
10 Ga0265323_10027296 3300028653 Bacteria 2145
11 Ga0265323_10058750 3300028653 Unclassified 1342
12 Ga0265322_10004741 3300028654 Bacteria 4036
13 Ga0265322_10019024 3300028654 Unclassified 1972
14 Ga0265322_10171533 3300028654 Bacteria 621
15 Ga0265338_10035744 3300028800 Bacteria 4766
16 Ga0265338_10048508 3300028800 Bacteria 3862
17 Ga0265338_10142305 3300028800 Bacteria 1877
18 Ga0265324_10006391 3300029957 Bacteria 4922
19 Ga0265324_10110085 3300029957 Archaea 935
20 Ga0265330_10000388 3300031235 Bacteria 30400
21 Ga0265330_10001239 3300031235 Bacteria 14982
22 Ga0265330_10008661 3300031235 Bacteria 4883
23 Ga0265330_10015306 3300031235 Bacteria 3550
24 Ga0265330_10029420 3300031235 Bacteria 2470
25 Ga0265330_10034835 3300031235 Bacteria 2248
26 Ga0265330_10037943 3300031235 Bacteria 2142
27 Ga0265332_10023080 3300031238 Bacteria 2744
28 Ga0265332_10191656 3300031238 Unclassified 851
29 Ga0265328_10050326 3300031239 Bacteria 1530
30 Ga0265328_10108539 3300031239 Bacteria 1031
31 Ga0265320_10016425 3300031240 Bacteria 4149
32 Ga0265325_10015587 3300031241 Bacteria 4269
33 Ga0265325_10060988 3300031241 Bacteria 1914
34 Ga0265329_10000870 3300031242 Bacteria 15259
35 Ga0265329_10001589 3300031242 Bacteria 10875
36 Ga0265329_10024129 3300031242 Bacteria 2020
37 Ga0265329_10046396 3300031242 Bacteria 1388
38 Ga0265340_10002037 3300031247 Bacteria 11580
39 Ga0265339_10000058 3300031249 Bacteria 98398
40 Ga0265339_10028823 3300031249 Bacteria 3154
41 Ga0265339_10066095 3300031249 Bacteria 1937
42 Ga0265331_10001482 3300031250 Bacteria 17320
43 Ga0265331_10020756 3300031250 Bacteria 3367
44 Ga0265327_10097444 3300031251 Bacteria 1425
45 Ga0265316_10000197 3300031344 Bacteria 69929
46 Ga0265316_10002062 3300031344 Bacteria 21157
47 Ga0265316_10003662 3300031344 Bacteria 15476
48 Ga0265316_10004212 3300031344 Bacteria 14369
49 Ga0265316_10007755 3300031344 Bacteria 10055
50 Ga0265316_10010815 3300031344 Bacteria 8289
51 Ga0265316_10017611 3300031344 Bacteria 6166
52 Ga0265316_10032319 3300031344 Bacteria 4270
53 Ga0265316_10448828 3300031344 Unclassified 925
54 Ga0265316_10463956 3300031344 Bacteria 907
55 Ga0265316_10524576 3300031344 Bacteria 844
56 Ga0265313_10005721 3300031595 Bacteria 9055
57 Ga0316575_10000185 3300031665 Bacteria 16288
58 Ga0316575_10008082 3300031665 Bacteria 3824
59 Ga0316579_10083246 3300031691 Bacteria 1525
60 Ga0265314_10000175 3300031711 Bacteria 95088
61 Ga0265314_10004156 3300031711 Bacteria 13617
62 Ga0265314_10054993 3300031711 Unclassified 2751
63 Ga0265342_10001527 3300031712 Bacteria 21406
64 Ga0265342_10003685 3300031712 Bacteria 12428
65 Ga0265342_10003950 3300031712 Bacteria 11892
66 Ga0265342_10007163 3300031712 Bacteria 8208
67 Ga0265342_10053838 3300031712 Bacteria 2393
68 Ga0265342_10092073 3300031712 Unclassified 1737
69 Ga0316576_10000306 3300031727 Bacteria 21739
70 Ga0316576_10001141 3300031727 Bacteria 13947
71 Ga0316576_10006799 3300031727 Bacteria 7146
72 Ga0316576_10009050 3300031727 Bacteria 6405
73 Ga0316576_10010165 3300031727 Bacteria 6103
74 Ga0316576_10012818 3300031727 Bacteria 5548
75 Ga0316576_10023995 3300031727 Bacteria 4256
76 Ga0316576_10083813 3300031727 Bacteria 2369
77 Ga0316576_10118094 3300031727 Bacteria 1991
78 Ga0316576_10136373 3300031727 Bacteria 1847
79 Ga0316576_10171411 3300031727 Bacteria 1638
80 Ga0316576_10240697 3300031727 Bacteria 1359
81 Ga0316576_10283840 3300031727 Unclassified 1239
82 Ga0316576_10389272 3300031727 Bacteria 1034
83 Ga0316576_10410602 3300031727 Bacteria 1003
84 Ga0316578_10008631 3300031728 Bacteria 5196
85 Ga0316578_10009494 3300031728 Bacteria 5006
86 Ga0316578_10023839 3300031728 Unclassified 3428
87 Ga0316578_10057491 3300031728 Bacteria 2285
88 Ga0316578_10107949 3300031728 Bacteria 1671
89 Ga0316578_10198997 3300031728 Unclassified 1206
90 Ga0316577_10001118 3300031733 Bacteria 12236
91 Ga0316577_10005572 3300031733 Bacteria 6609
92 Ga0316577_10027296 3300031733 Bacteria 3183
93 Ga0316577_10273008 3300031733 Bacteria 957
94 Ga0316577_10337102 3300031733 Bacteria 856
95 Ga0316583_10038767 3300032133 Bacteria 1688
96 Ga0316585_10002099 3300032137 Bacteria 5351
97 Ga0316585_10032606 3300032137 Bacteria 1641
98 Ga0316580_10003551 3300032139 Bacteria 4439
99 Ga0316593_10033535 3300032168 Bacteria 1681
100 Ga0316596_1083506 3300033541 Bacteria 859
101 Ga0316574_0008068 3300035398 Bacteria 5824
102 Ga0316574_0018322 3300035398 Bacteria 4113
103 Ga0316574_0041145 3300035398 Bacteria 2848
104 Ga0316574_0089789 3300035398 Bacteria 1958
105 Ga0316574_0455431 3300035398 Bacteria 801
106 Ga0316582_0005247 3300036647 Bacteria 6644
107 Ga0316582_0007383 3300036647 Bacteria 5846
108 Ga0316582_0040115 3300036647 Bacteria 2920
109 Ga0316582_0095582 3300036647 Bacteria 1961
110 Ga0316584_0000033 3300036712 Bacteria 49025
111 Ga0316584_0001450 3300036712 Bacteria 14216
112 Ga0316584_0006557 3300036712 Bacteria 7882
113 Ga0316584_0032833 3300036712 Bacteria 3841
114 Ga0316584_0049863 3300036712 Bacteria 3129
115 Ga0316584_0065977 3300036712 Bacteria 2712
116 Ga0316584_0102975 3300036712 Bacteria 2137
117 Ga0316584_0124248 3300036712 Bacteria 1928
118 Ga0316584_0264004 3300036712 Unclassified 1255
119 Ga0316581_0019631 3300037588 Bacteria 1973
120 Ga0400490_09514 3300038726 Bacteria 11262
121 Ga0400490_10180 3300038726 Bacteria 44288
122 Ga0400491_12966 3300038727 Bacteria 4546
123 Ga0400489_91995 3300039093 Bacteria 1482
124 Ga0451577_0003439 3300042876 Bacteria 17629
125 Ga0451577_0011021 3300042876 Bacteria 8587
126 Ga0451577_0019165 3300042876 Bacteria 6293
127 Ga0451577_0087240 3300042876 Bacteria 2784
128 Ga0451577_0135599 3300042876 Bacteria 2210
129 Ga0451577_0141574 3300042876 Bacteria 2161
130 Ga0451577_0150246 3300042876 Bacteria 2096
131 Ga0453683_0001246 3300044673 Bacteria 22711
132 Ga0453683_0394515 3300044673 Unclassified 892
133 Ga0453684_0009003 3300044712 Bacteria 17629
134 Ga0453684_0021400 3300044712 Bacteria 9663
135 Ga0453684_0067436 3300044712 Bacteria 4550
136 Ga0453684_0125621 3300044712 Bacteria 3088
137 Ga0453684_0137535 3300044712 Bacteria 2922
138 Ga0453684_0257079 3300044712 Bacteria 2003
139 Ga0453684_0517547 3300044712 Bacteria 1319
140 Ga0453684_1462534 3300044712 Bacteria 706
141 Ga0451576_0000111 3300045051 Bacteria 209824
142 Ga0451576_0049772 3300045051 Bacteria 4398
143 Ga0451576_0060340 3300045051 Unclassified 3957
144 Ga0451576_0720170 3300045051 Bacteria 1048
145 Ga0451576_0996170 3300045051 Unclassified 878
146 Ga0451576_1649022 3300045051 Bacteria 665
147 Ga0501036_0135604 3300049572 Bacteria 2078
148 Ga0501071_0382955 3300049587 Bacteria 1073
149 Ga0265316_10035867
150 Ga0265337_1004753
151 Ga0265326_10031540
152 Ga0265318_10088579
153 Ga0265318_10171763
154 Ga0265323_10000907
155 Ga0265323_10003281
156 Ga0265323_10003633
157 Ga0265323_10025042
158 Ga0265323_10027296
159 Ga0265323_10058750
160 Ga0265322_10004741
161 Ga0265322_10019024
162 Ga0265322_10171533
163 Ga0265338_10035744
164 Ga0265338_10048508
165 Ga0265338_10142305
166 Ga0265324_10006391
167 Ga0265324_10110085
168 Ga0265330_10000388
169 Ga0265330_10001239
170 Ga0265330_10008661
171 Ga0265330_10015306
172 Ga0265330_10029420
173 Ga0265330_10034835
174 Ga0265330_10037943
175 Ga0265332_10023080
176 Ga0265332_10191656
177 Ga0265328_10050326
178 Ga0265328_10108539
179 Ga0265320_10016425
180 Ga0265325_10015587
181 Ga0265325_10060988
182 Ga0265329_10000870
183 Ga0265329_10001589
184 Ga0265329_10024129
185 Ga0265329_10046396
186 Ga0265340_10002037
187 Ga0265339_10000058
188 Ga0265339_10028823
189 Ga0265339_10066095
190 Ga0265331_10001482
191 Ga0265331_10020756
192 Ga0265327_10097444
193 Ga0265316_10000197
194 Ga0265316_10002062
195 Ga0265316_10003662
196 Ga0265316_10004212
197 Ga0265316_10007755
198 Ga0265316_10010815
199 Ga0265316_10017611
200 Ga0265316_10032319
201 Ga0265316_10448828
202 Ga0265316_10463956
203 Ga0265316_10524576
204 Ga0265313_10005721
205 Ga0316575_10000185
206 Ga0316575_10008082
207 Ga0316579_10083246
208 Ga0265314_10000175
209 Ga0265314_10004156
210 Ga0265314_10054993
211 Ga0265342_10001527
212 Ga0265342_10003685
213 Ga0265342_10003950
214 Ga0265342_10007163
215 Ga0265342_10053838
216 Ga0265342_10092073
217 Ga0316576_10000306
218 Ga0316576_10001141
219 Ga0316576_10006799
220 Ga0316576_10009050
221 Ga0316576_10010165
222 Ga0316576_10012818
223 Ga0316576_10023995
224 Ga0316576_10083813
225 Ga0316576_10118094
226 Ga0316576_10136373
227 Ga0316576_10171411
228 Ga0316576_10240697
229 Ga0316576_10283840
230 Ga0316576_10389272
231 Ga0316576_10410602
232 Ga0316578_10008631
233 Ga0316578_10009494
234 Ga0316578_10023839
235 Ga0316578_10057491
236 Ga0316578_10107949
237 Ga0316578_10198997
238 Ga0316577_10001118
239 Ga0316577_10005572
240 Ga0316577_10027296
241 Ga0316577_10273008
242 Ga0316577_10337102
243 Ga0316583_10038767
244 Ga0316585_10002099
245 Ga0316585_10032606
246 Ga0316580_10003551
247 Ga0316593_10033535
248 Ga0316596_1083506
249 Ga0316574_0008068
250 Ga0316574_0018322
251 Ga0316574_0041145
252 Ga0316574_0089789
253 Ga0316574_0455431
254 Ga0316582_0005247
255 Ga0316582_0007383
256 Ga0316582_0040115
257 Ga0316582_0095582
258 Ga0316584_0000033
259 Ga0316584_0001450
260 Ga0316584_0006557
261 Ga0316584_0032833
262 Ga0316584_0049863
263 Ga0316584_0065977
264 Ga0316584_0102975
265 Ga0316584_0124248
266 Ga0316584_0264004
267 Ga0316581_0019631
268 Ga0400490_09514
269 Ga0400490_10180
270 Ga0400491_12966
271 Ga0400489_91995
272 Ga0451577_0003439
273 Ga0451577_0011021
274 Ga0451577_0019165
275 Ga0451577_0087240
276 Ga0451577_0135599
277 Ga0451577_0141574
278 Ga0451577_0150246
279 Ga0453683_0001246
280 Ga0453683_0394515
281 Ga0453684_0009003
282 Ga0453684_0021400
283 Ga0453684_0067436
284 Ga0453684_0125621
285 Ga0453684_0137535
286 Ga0453684_0257079
287 Ga0453684_0517547
288 Ga0453684_1462534
289 Ga0451576_0000111
290 Ga0451576_0049772
291 Ga0451576_0060340
292 Ga0451576_0720170
293 Ga0451576_0996170
294 Ga0451576_1649022
295 Ga0501036_0135604
296 Ga0501071_0382955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

41

204

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.9159 4 179
3on3-assembly3.cif.gz_B the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.9057 1 179
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.9004 4 179
3g2e-assembly1.cif.gz_A structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8919 16 177
3g2e-assembly1.cif.gz_C structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8886 2 177
ID Description Score Start End Superfamily
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8892 4 182 3.40.920.10
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8886 2 177 3.40.920.10
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8791 4 182 3.40.920.10
af_Q57717_1_177_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8622 4 180 3.40.920.10
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8568 2 177 3.40.920.10
ID Description Score Start End GO Terms
AF-A0A7V1ZHL4-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9678 27 181 GO:0016903
AF-A0A523TTX9-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9636 2 181 GO:0016020
GO:0016903
AF-A0A7C5HJL1-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9634 4 176 GO:0016903
AF-A0A7C0Y387-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9617 3 181 GO:0016020
GO:0016903
AF-A0A846ZVT7-F1-model_v4 Pyruvate ferredoxin oxidoreductase 0.9596 19 181 GO:0016903

Map