F203363

General Info

Members Datasets Scaffolds Average Seq Length
148 119 119 328

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10014546|Ga0207657_100145466
Length 380
Sequence MPAIETRGLTKTYVSHKKEPGILGSLKGLFTKEKVEVQAVQSVDLEIGQGELVGFLGPNGAGKTTTLKMLSGILYPSGGEAKVLGYTPHHRKPEMLRQISLVMGNKMQLWWDLPAWDSFVVLKELYEVSDAQFKKRSDHLVEVLDLGDKIHTQVRKLSLGERMKCELVAALLHSPRVIFLDEPTIGLDVVSQKRIREFLKQLHQEDNCTIILTSHYMQDVQELCDRVVVIDHGQLVFEGKLEELSNRYSETRRIRLAFSTEVSLTDLEKFGKVIESEPLLATFEVPRQETTKATARMLQHLPVSDVAIQEVDIEDVIRDVAQTGVKVVMSTHDLGQARRLGGDIVLLHRGRLIEHTQASDFFDNPRTPEARRFIAGELLV

Samples

Sample ID Description Type Environment
1 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
2 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
3 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
4 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
5 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
6 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
7 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
8 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
9 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
10 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
11 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
12 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
13 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
14 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
15 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
16 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
17 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
18 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
19 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
20 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
21 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
22 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
23 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
24 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
25 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
77 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
83 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
118 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
119 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.05
Metatranscriptomes 1.35
Isolates 19.59

Biome Distribution

Category Percentage (%)
Aerial Root 1.35
Bulb 0
Endosphere 2.7
Nodule 3.38
Rhizoplane 2.03
Rhizosphere 70.95
Stem 0
Stem Tuber 0
Unclassified 19.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10089812 3300003323 Bacteria 2625
2 JGI25405J52794_10008470 3300003911 Bacteria 1921
3 Ga0065715_10011873 3300005293 Bacteria 2349
4 Ga0070658_10000910 3300005327 Bacteria 25346
5 Ga0070666_10140089 3300005335 Bacteria 1685
6 Ga0070660_100002581 3300005339 Bacteria 12430
7 Ga0070660_100003675 3300005339 Bacteria 10596
8 Ga0070711_100001116 3300005439 Bacteria 14358
9 Ga0068853_100339230 3300005539 Bacteria 1396
10 Ga0070686_100328716 3300005544 Bacteria 1142
11 Ga0068855_100109260 3300005563 Bacteria 3176
12 Ga0068863_100000827 3300005841 Bacteria 31061
13 Ga0081539_10020461 3300005985 Bacteria 4471
14 Ga0075431_100017292 3300006847 Bacteria 7328
15 Ga0075431_100018980 3300006847 Bacteria 7005
16 Ga0068865_100129064 3300006881 Bacteria 1892
17 Ga0075436_100245784 3300006914 Bacteria 1273
18 Ga0079104_1000329 3300006946 Bacteria 58106
19 Ga0079104_1000622 3300006946 Bacteria 34711
20 Ga0105251_10007078 3300009011 Bacteria 6990
21 Ga0105244_10066877 3300009036 Bacteria 1799
22 Ga0105240_10000223 3300009093 Bacteria 113647
23 Ga0114129_10182126 3300009147 Bacteria 2858
24 Ga0105237_10000003 3300009545 Bacteria 556908
25 Ga0105237_10000392 3300009545 Bacteria 62305
26 Ga0105237_10004006 3300009545 Bacteria 17226
27 Ga0105238_10152420 3300009551 Bacteria 2286
28 Ga0105239_10036710 3300010375 Bacteria 5377
29 Ga0105239_10071351 3300010375 Bacteria 3816
30 Ga0105246_10003836 3300011119 Bacteria 9115
31 Ga0157374_10112143 3300013296 Bacteria 2624
32 Ga0157378_10331649 3300013297 Bacteria 1481
33 Ga0157372_10024202 3300013307 Bacteria 6592
34 Ga0157375_10316739 3300013308 Bacteria 1724
35 Ga0213876_10060262 3300021384 Bacteria 2002
36 Ga0213875_10046431 3300021388 Bacteria 2038
37 Ga0209566_107368 3300025225 Bacteria 1240
38 Ga0209437_100738 3300025233 Bacteria 16283
39 Ga0207655_1021648 3300025728 Bacteria 3255
40 Ga0207642_10171870 3300025899 Bacteria 1173
41 Ga0207680_10118671 3300025903 Bacteria 1727
42 Ga0207705_10001080 3300025909 Bacteria 22137
43 Ga0207695_10000326 3300025913 Bacteria 113674
44 Ga0207671_10000012 3300025914 Bacteria 519494
45 Ga0207671_10000108 3300025914 Bacteria 128664
46 Ga0207657_10014546 3300025919 Bacteria 7673
47 Ga0207657_10107189 3300025919 Bacteria 2311
48 Ga0207703_10119062 3300026035 Bacteria 2264
49 Ga0207708_10119842 3300026075 Bacteria 2050
50 Ga0209281_1000153 3300027111 Bacteria 166921
51 Ga0209281_1000252 3300027111 Bacteria 106924
52 Ga0265338_10000071 3300028800 Bacteria 184107
53 Ga0265338_10000736 3300028800 Bacteria 55849
54 Ga0265324_10000944 3300029957 Bacteria 18201
55 Ga0307511_10002795 3300030521 Bacteria 18127
56 Ga0265331_10060687 3300031250 Bacteria 1786
57 Ga0316576_10008376 3300031727 Bacteria 6589
58 Ga0316578_10016123 3300031728 Bacteria 4037
59 Ga0307507_10027164 3300033179 Bacteria 6144
60 Ga0373943_0032099 3300035170 Bacteria 2495
61 Ga0316582_0002004 3300036647 Bacteria 9345
62 Ga0316584_0051630 3300036712 Bacteria 3075
63 Ga0316584_0087752 3300036712 Bacteria 2329
64 Ga0316584_0313772 3300036712 Bacteria 1133
65 Ga0373925_0005840 3300037068 Bacteria 9132
66 Ga0395900_0005656 3300037418 Bacteria 13073
67 Ga0395898_0003171 3300037466 Bacteria 18527
68 Ga0436364_0979827 3300037853 Bacteria 16069
69 Ga0400483_141423 3300039062 Bacteria 1868
70 Ga0400489_30971 3300039093 Bacteria 5477
71 Ga0436365_0796272 3300039437 Bacteria 31906
72 Ga0439439_0027264 3300041406 Bacteria 1443
73 Ga0439449_0013903 3300042007 Bacteria 3027
74 Ga0451577_0376346 3300042876 Bacteria 1288
75 Ga0466969_0006065 3300044656 Bacteria 6431
76 Ga0466972_0018241 3300044658 Bacteria 3508
77 Ga0453683_0171508 3300044673 Bacteria 1374
78 Ga0466965_0009293 3300044683 Bacteria 4568
79 Ga0466965_0151514 3300044683 Bacteria 1212
80 Ga0453684_0000581 3300044712 Bacteria 136088
81 Ga0453684_0001027 3300044712 Bacteria 89253
82 Ga0453684_0001460 3300044712 Bacteria 66976
83 Ga0453684_0001537 3300044712 Bacteria 64502
84 Ga0453684_0006759 3300044712 Bacteria 21584
85 Ga0453684_0013769 3300044712 Bacteria 13076
86 Ga0453684_0027968 3300044712 Bacteria 8065
87 Ga0453684_0055080 3300044712 Bacteria 5173
88 Ga0453684_0119944 3300044712 Bacteria 3178
89 Ga0453684_0143427 3300044712 Bacteria 2848
90 Ga0453684_0195284 3300044712 Bacteria 2364
91 Ga0453684_0396103 3300044712 Unclassified 1547
92 Ga0466968_0007795 3300044735 Bacteria 4082
93 Ga0466957_0105697 3300044842 Unclassified 1780
94 Ga0466960_0001014 3300044901 Bacteria 10033
95 Ga0466959_0000830 3300045049 Bacteria 18236
96 Ga0451576_0104639 3300045051 Bacteria 2944
97 Ga0451576_0114404 3300045051 Bacteria 2808
98 Ga0495660_0058998 3300046810 Bacteria 2065
99 Ga0496110_0587720 3300048913 Bacteria 1011
100 Ga0496115_0003512 3300048918 Bacteria 11266
101 Ga0496116_0033615 3300048919 Bacteria 3635
102 Ga0496117_0018702 3300048920 Bacteria 5724
103 Ga0496119_0034137 3300048922 Bacteria 3357
104 Ga0496120_0121422 3300048923 Bacteria 1350
105 Ga0496122_0097907 3300048925 Bacteria 1972
106 Ga0496123_0038391 3300048926 Bacteria 3367
107 Ga0496124_0074949 3300048927 Bacteria 2796
108 Ga0496124_0116660 3300048927 Bacteria 2140
109 Ga0496126_0004115 3300048929 Bacteria 17601
110 nmdc:mga05p37_222803_c1 3300050507 Bacteria 2275
111 nmdc:mga05p37_7605_c1 3300050507 Bacteria 12784
112 nmdc:mga0qj67_14264_c1 3300050509 Bacteria 6005
113 nmdc:mga06r32_11518_c1 3300050510 Bacteria 7967
114 nmdc:mga06r32_2912_c1 3300050510 Bacteria 15350
115 nmdc:mga0a205_102746_c1 3300050515 Bacteria 2756
116 Ga0500555_000003 3300053103 Bacteria 392994
117 Ga0500616_0000050 3300053153 Bacteria 299099
118 Ga0587082_000085 3300059504 Bacteria 5119
119 Ga0587079_000014 3300059647 Bacteria 9213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10060262 Ga0213876_100602623 279
2 3300021388 Ga0213875_10046431 Ga0213875_100464312 279
3 3300037853 Ga0436364_0979827 Ga0436364_0979827_4263_5126 279
4 3300039437 Ga0436365_0796272 Ga0436365_0796272_26589_27452 279
5 iso_pu_bacteria 2984527788 2984528585 280
6 iso_pu_bacteria 2984532647 2984534689 280
7 3300048913 Ga0496110_0587720 Ga0496110_0587720_14_907 289
8 3300041406 Ga0439439_0027264 Ga0439439_0027264_474_1379 290
9 3300044658 Ga0466972_0018241 Ga0466972_0018241_308_1297 301
10 3300044683 Ga0466965_0009293 Ga0466965_0009293_2917_3906 301
11 3300044735 Ga0466968_0007795 Ga0466968_0007795_2926_3915 301
12 3300044901 Ga0466960_0001014 Ga0466960_0001014_259_1248 301
13 3300026035 Ga0207703_10119062 Ga0207703_101190622 305
14 3300005539 Ga0068853_100339230 Ga0068853_1003392302 311
15 3300048926 Ga0496123_0038391 Ga0496123_0038391_2397_3344 313
16 3300028800 Ga0265338_10000071 Ga0265338_10000071115 314
17 iso_pu_bacteria 2875391855 2875396553 315
18 3300005544 Ga0070686_100328716 Ga0070686_1003287161 316
19 3300029957 Ga0265324_10000944 Ga0265324_1000094410 316
20 iso_pu_bacteria 2995948881 2995951728 317
21 3300009011 Ga0105251_10007078 Ga0105251_100070785 318
22 3300009036 Ga0105244_10066877 Ga0105244_100668772 318
23 3300011119 Ga0105246_10003836 Ga0105246_1000383610 318
24 3300025728 Ga0207655_1021648 Ga0207655_10216482 318
25 3300048919 Ga0496116_0033615 Ga0496116_0033615_792_1781 318
26 3300048927 Ga0496124_0116660 Ga0496124_0116660_875_1864 318
27 iso_pu_bacteria 2971403814 2971405358 318
28 3300033179 Ga0307507_10027164 Ga0307507_100271644 319
29 3300048923 Ga0496120_0121422 Ga0496120_0121422_318_1277 319
30 iso_pu_bacteria 2675903058 2676477753 319
31 iso_pu_bacteria 2721755693 2723605644 319
32 iso_pu_bacteria 2728369359 2730136320 319
33 iso_pu_bacteria 2751185905 2753810288 319
34 iso_pu_bacteria 2786546517 2787437248 319
35 iso_pu_bacteria 2802428803 2802438758 319
36 iso_pu_bacteria 2816332336 2817616879 319
37 iso_pu_bacteria 2827628540 2827634330 319
38 iso_pu_bacteria 2864733723 2864737027 319
39 iso_pu_bacteria 2885526491 2885531578 319
40 iso_pu_bacteria 2889276214 2889281623 319
41 iso_pu_bacteria 2904162308 2904163888 319
42 iso_pu_bacteria 2904595352 2904599052 319
43 iso_pu_bacteria 2907202186 2907203604 319
44 iso_pu_bacteria 2929206907 2929211647 319
45 iso_pu_bacteria 2939679117 2939683391 319
46 iso_pu_bacteria 2939702853 2939704172 319
47 iso_pu_bacteria 2971403814 2971407526 319
48 iso_pu_bacteria 2996706504 2996710332 319
49 iso_pu_bacteria 648028048 648171692 319
50 iso_pu_bacteria 8054795415 8054797107 319
51 iso_pu_bacteria 8055632911 8055635277 319
52 3300003911 JGI25405J52794_10008470 JGI25405J52794_100084702 320
53 3300005293 Ga0065715_10011873 Ga0065715_100118731 320
54 3300005985 Ga0081539_10020461 Ga0081539_100204613 320
55 3300006847 Ga0075431_100017292 Ga0075431_1000172922 320
56 3300006914 Ga0075436_100245784 Ga0075436_1002457841 320
57 3300006946 Ga0079104_1000329 Ga0079104_100032939 320
58 3300009147 Ga0114129_10182126 Ga0114129_101821262 320
59 3300013307 Ga0157372_10024202 Ga0157372_100242022 320
60 3300027111 Ga0209281_1000252 Ga0209281_100025247 320
61 3300031727 Ga0316576_10008376 Ga0316576_100083763 320
62 3300031728 Ga0316578_10016123 Ga0316578_100161233 320
63 3300036647 Ga0316582_0002004 Ga0316582_0002004_3267_4262 320
64 3300036712 Ga0316584_0051630 Ga0316584_0051630_456_1451 320
65 3300036712 Ga0316584_0087752 Ga0316584_0087752_1221_2216 320
66 3300036712 Ga0316584_0313772 Ga0316584_0313772_106_1104 320
67 3300039093 Ga0400489_30971 Ga0400489_30971_2796_3785 320
68 3300044712 Ga0453684_0027968 Ga0453684_0027968_2004_3044 320
69 3300044712 Ga0453684_0195284 Ga0453684_0195284_471_1493 320
70 3300050507 nmdc:mga05p37_222803_c1 nmdc:mga05p37_222803_c1_1081_2070 320
71 3300050510 nmdc:mga06r32_2912_c1 nmdc:mga06r32_2912_c1_13720_14736 320
72 3300050515 nmdc:mga0a205_102746_c1 nmdc:mga0a205_102746_c1_560_1549 320
73 3300003323 rootH1_10089812 rootH1_100898123 321
74 3300005327 Ga0070658_10000910 Ga0070658_100009104 321
75 3300005335 Ga0070666_10140089 Ga0070666_101400892 321
76 3300005339 Ga0070660_100002581 Ga0070660_10000258113 321
77 3300005339 Ga0070660_100003675 Ga0070660_1000036756 321
78 3300005439 Ga0070711_100001116 Ga0070711_1000011167 321
79 3300005563 Ga0068855_100109260 Ga0068855_1001092604 321
80 3300005841 Ga0068863_100000827 Ga0068863_10000082726 321
81 3300006847 Ga0075431_100018980 Ga0075431_1000189801 321
82 3300006881 Ga0068865_100129064 Ga0068865_1001290642 321
83 3300006946 Ga0079104_1000622 Ga0079104_100062219 321
84 3300009093 Ga0105240_10000223 Ga0105240_1000022379 321
85 3300009545 Ga0105237_10000003 Ga0105237_10000003503 321
86 3300009545 Ga0105237_10000392 Ga0105237_1000039257 321
87 3300009545 Ga0105237_10004006 Ga0105237_100040062 321
88 3300009551 Ga0105238_10152420 Ga0105238_101524204 321
89 3300010375 Ga0105239_10036710 Ga0105239_100367105 321
90 3300010375 Ga0105239_10071351 Ga0105239_100713513 321
91 3300013296 Ga0157374_10112143 Ga0157374_101121432 321
92 3300013297 Ga0157378_10331649 Ga0157378_103316492 321
93 3300013308 Ga0157375_10316739 Ga0157375_103167392 321
94 3300025225 Ga0209566_107368 Ga0209566_1073682 321
95 3300025233 Ga0209437_100738 Ga0209437_10073811 321
96 3300025899 Ga0207642_10171870 Ga0207642_101718702 321
97 3300025903 Ga0207680_10118671 Ga0207680_101186712 321
98 3300025909 Ga0207705_10001080 Ga0207705_1000108022 321
99 3300025913 Ga0207695_10000326 Ga0207695_1000032681 321
100 3300025914 Ga0207671_10000012 Ga0207671_100000125 321
101 3300025914 Ga0207671_10000108 Ga0207671_1000010850 321
102 3300025919 Ga0207657_10014546 Ga0207657_100145466 321
103 3300025919 Ga0207657_10107189 Ga0207657_101071892 321
104 3300026075 Ga0207708_10119842 Ga0207708_101198422 321
105 3300027111 Ga0209281_1000153 Ga0209281_100015317 321
106 3300028800 Ga0265338_10000736 Ga0265338_1000073647 321
107 3300030521 Ga0307511_10002795 Ga0307511_1000279513 321
108 3300031250 Ga0265331_10060687 Ga0265331_100606872 321
109 3300035170 Ga0373943_0032099 Ga0373943_0032099_264_1244 321
110 3300037068 Ga0373925_0005840 Ga0373925_0005840_2194_3171 321
111 3300037418 Ga0395900_0005656 Ga0395900_0005656_3720_4700 321
112 3300037466 Ga0395898_0003171 Ga0395898_0003171_15144_16124 321
113 3300039062 Ga0400483_141423 Ga0400483_141423_846_1838 321
114 3300042007 Ga0439449_0013903 Ga0439449_0013903_323_1327 321
115 3300042876 Ga0451577_0376346 Ga0451577_0376346_236_1219 321
116 3300044656 Ga0466969_0006065 Ga0466969_0006065_940_1944 321
117 3300044673 Ga0453683_0171508 Ga0453683_0171508_39_1055 321
118 3300044683 Ga0466965_0151514 Ga0466965_0151514_92_1096 321
119 3300044712 Ga0453684_0000581 Ga0453684_0000581_18205_19233 321
120 3300044712 Ga0453684_0001027 Ga0453684_0001027_15646_16620 321
121 3300044712 Ga0453684_0001460 Ga0453684_0001460_34945_35928 321
122 3300044712 Ga0453684_0001537 Ga0453684_0001537_35881_36876 321
123 3300044712 Ga0453684_0006759 Ga0453684_0006759_17738_18730 321
124 3300044712 Ga0453684_0013769 Ga0453684_0013769_4863_5858 321
125 3300044712 Ga0453684_0055080 Ga0453684_0055080_2793_3785 321
126 3300044712 Ga0453684_0119944 Ga0453684_0119944_1338_2333 321
127 3300044712 Ga0453684_0143427 Ga0453684_0143427_1003_1998 321
128 3300044712 Ga0453684_0396103 Ga0453684_0396103_218_1213 321
129 3300044842 Ga0466957_0105697 Ga0466957_0105697_111_1106 321
130 3300045049 Ga0466959_0000830 Ga0466959_0000830_15025_16029 321
131 3300045051 Ga0451576_0104639 Ga0451576_0104639_872_1849 321
132 3300045051 Ga0451576_0114404 Ga0451576_0114404_1741_2718 321
133 3300046810 Ga0495660_0058998 Ga0495660_0058998_294_1268 321
134 3300048918 Ga0496115_0003512 Ga0496115_0003512_8662_9726 321
135 3300048920 Ga0496117_0018702 Ga0496117_0018702_862_1854 321
136 3300048922 Ga0496119_0034137 Ga0496119_0034137_294_1286 321
137 3300048925 Ga0496122_0097907 Ga0496122_0097907_270_1262 321
138 3300048927 Ga0496124_0074949 Ga0496124_0074949_1625_2617 321
139 3300048929 Ga0496126_0004115 Ga0496126_0004115_15104_16096 321
140 3300050507 nmdc:mga05p37_7605_c1 nmdc:mga05p37_7605_c1_435_1541 321
141 3300050509 nmdc:mga0qj67_14264_c1 nmdc:mga0qj67_14264_c1_859_1974 321
142 3300050510 nmdc:mga06r32_11518_c1 nmdc:mga06r32_11518_c1_6312_7424 321
143 3300053103 Ga0500555_000003 Ga0500555_000003_175090_176070 321
144 3300053153 Ga0500616_0000050 Ga0500616_0000050_49730_50731 321
145 3300059504 Ga0587082_000085 Ga0587082_000085_720_1724 321
146 3300059647 Ga0587079_000014 Ga0587079_000014_7489_8493 321
147 iso_pu_bacteria 2524023129 2524185887 321
148 iso_pu_bacteria 2971410472 2971416833 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

185

0.89

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

117

216

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.8976 2 246
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.8965 2 246
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.8921 2 246
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.8902 2 238
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.8898 2 245
ID Description Score Start End Superfamily
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9458 2 242 3.40.50.300
af_Q8T6J5_1286_1532_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9438 2 246 3.40.50.300
af_Q4DWA3_1535_1779_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9429 2 242 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9428 2 245 3.40.50.300
af_A4HRM7_1245_1429_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9388 63 245 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V5DKD2-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9559 1 238 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A1D2R6P7-F1-model_v4 ABC transporter domain-containing protein 0.9424 1 246 GO:0005524
GO:0016887
AF-A0A535F3M6-F1-model_v4 ABC transporter ATP-binding protein 0.9418 1 245 GO:0005524
GO:0016887
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9397 2 203 GO:0005524
GO:0016887
AF-A0A7T7XM26-F1-model_v4 ABC transporter ATP-binding protein 0.9389 2 244 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.15 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map