F203167

General Info

Members Datasets Scaffolds Average Seq Length
148 112 296 153

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_11678092|Ga0157370_116780921
Length 167
Sequence MTTTGSTTDDDTIELRLARVLPATPEEVFDAYTDAEKQRTWFSILDTTPGIVEIEVDLRVGGTQTAVWGPDRDTLFRETQTFLVIDRPAEGHSGRLVTESSGSGPWAPGHPDGLTMTTHVEVTFEAVEGGTLMTVVQSGFPDVEVRDFFGSMAWIGAFDRIEAFLTR

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
61 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
62 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
63 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
64 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
65 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
66 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
67 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
70 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
71 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
76 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
77 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
83 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
84 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
85 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
86 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
87 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
88 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
89 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
90 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
91 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
92 2501939600 Micromonospora sp. L5 Isolate Unclassified
93 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
94 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
95 2643221572 Leifsonia sp. Root60 Isolate Unclassified
96 2643221619 Agromyces sp. Root81 Isolate Unclassified
97 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
98 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
99 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
100 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
101 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
102 2808606372 Agromyces sp. 23-23 Isolate Unclassified
103 2855683550 Micromonospora sp. RP3T Isolate Unclassified
104 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
105 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
106 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
107 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
108 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
109 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
110 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
111 649633069 Micromonospora sp. L5 Isolate Unclassified
112 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.81
Metatranscriptomes 0
Isolates 14.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.73
Nodule 0
Rhizoplane 9.46
Rhizosphere 68.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_11678092 3300013104 Bacteria 570
2 Ga0070658_10332799 3300005327 Bacteria 1298
3 Ga0068869_100799190 3300005334 Bacteria 811
4 Ga0070668_100003772 3300005347 Bacteria 11189
5 Ga0070668_100182295 3300005347 Bacteria 1716
6 Ga0070668_100249474 3300005347 Bacteria 1473
7 Ga0070669_100232665 3300005353 Bacteria 1461
8 Ga0070673_100759934 3300005364 Bacteria 893
9 Ga0070667_101229637 3300005367 Bacteria 701
10 Ga0070700_101211154 3300005441 Bacteria 631
11 Ga0070663_100969835 3300005455 Bacteria 738
12 Ga0070678_100567752 3300005456 Bacteria 1009
13 Ga0068857_100460839 3300005577 Bacteria 1189
14 Ga0068854_102007983 3300005578 Bacteria 533
15 Ga0068861_100209075 3300005719 Bacteria 1643
16 Ga0068870_10237724 3300005840 Bacteria 1123
17 Ga0068862_100175062 3300005844 Bacteria 1923
18 Ga0068865_100605874 3300006881 Bacteria 926
19 Ga0105244_10081723 3300009036 Bacteria 1598
20 Ga0111539_10141152 3300009094 Bacteria 2820
21 Ga0105243_10234563 3300009148 Bacteria 1630
22 Ga0105243_10316711 3300009148 Bacteria 1420
23 Ga0105242_12297386 3300009176 Bacteria 586
24 Ga0105246_10135984 3300011119 Bacteria 1842
25 Ga0105246_11047851 3300011119 Bacteria 741
26 Ga0157370_10238642 3300013104 Bacteria 1682
27 Ga0157369_10067415 3300013105 Bacteria 3847
28 Ga0157375_10304653 3300013308 Bacteria 1757
29 Ga0157375_10362216 3300013308 Bacteria 1616
30 Ga0157375_11326421 3300013308 Bacteria 846
31 Ga0163163_10307268 3300014325 Bacteria 1638
32 Ga0163163_11791916 3300014325 Bacteria 674
33 Ga0157380_10009655 3300014326 Bacteria 6919
34 Ga0157379_10945719 3300014968 Bacteria 819
35 Ga0163161_10234298 3300017792 Bacteria 1425
36 Ga0163161_10580555 3300017792 Bacteria 922
37 Ga0163161_11164332 3300017792 Bacteria 665
38 Ga0207688_10326316 3300025901 Bacteria 942
39 Ga0207643_10217771 3300025908 Bacteria 1167
40 Ga0207643_10288897 3300025908 Bacteria 1018
41 Ga0207705_10307416 3300025909 Bacteria 1217
42 Ga0207681_10197920 3300025923 Bacteria 1541
43 Ga0207659_10283633 3300025926 Bacteria 1355
44 Ga0207709_10105326 3300025935 Bacteria 1874
45 Ga0207669_10971218 3300025937 Bacteria 713
46 Ga0207704_10444948 3300025938 Bacteria 1033
47 Ga0207691_10087510 3300025940 Bacteria 2795
48 Ga0207651_10699637 3300025960 Bacteria 893
49 Ga0207668_10002345 3300025972 Bacteria 11050
50 Ga0207668_11728597 3300025972 Bacteria 565
51 Ga0207658_11080758 3300025986 Bacteria 733
52 Ga0207678_10649862 3300026067 Bacteria 926
53 Ga0207678_10818253 3300026067 Bacteria 823
54 Ga0207708_10880916 3300026075 Bacteria 774
55 Ga0207674_10726149 3300026116 Bacteria 959
56 Ga0207675_100325151 3300026118 Bacteria 1502
57 Ga0207683_10279911 3300026121 Bacteria 1524
58 Ga0207683_10464039 3300026121 Bacteria 1168
59 Ga0207698_10587442 3300026142 Bacteria 1096
60 Ga0268266_10176478 3300028379 Bacteria 1943
61 Ga0268265_10144851 3300028380 Bacteria 1994
62 Ga0268265_11184827 3300028380 Bacteria 761
63 Ga0307515_10000149 3300028794 Bacteria 169663
64 Ga0307516_10000682 3300031730 Bacteria 46020
65 Ga0307405_10277240 3300031731 Bacteria 1260
66 Ga0307405_10650726 3300031731 Bacteria 867
67 Ga0307405_10822847 3300031731 Bacteria 780
68 Ga0307413_10933711 3300031824 Bacteria 739
69 Ga0307413_11051434 3300031824 Bacteria 701
70 Ga0307413_11436073 3300031824 Bacteria 608
71 Ga0307410_10123706 3300031852 Bacteria 1890
72 Ga0307406_10960130 3300031901 Bacteria 731
73 Ga0307406_11083358 3300031901 Bacteria 691
74 Ga0307412_10269912 3300031911 Bacteria 1331
75 Ga0307409_100195222 3300031995 Bacteria 1806
76 Ga0307409_100294374 3300031995 Bacteria 1507
77 Ga0307409_100655736 3300031995 Bacteria 1044
78 Ga0307409_100742503 3300031995 Bacteria 985
79 Ga0307409_100996138 3300031995 Bacteria 856
80 Ga0307409_101462081 3300031995 Bacteria 710
81 Ga0307416_100692060 3300032002 Bacteria 1108
82 Ga0307416_102685972 3300032002 Bacteria 595
83 Ga0307414_10183919 3300032004 Bacteria 1684
84 Ga0307414_11162593 3300032004 Bacteria 714
85 Ga0307411_10657592 3300032005 Bacteria 908
86 Ga0307411_11580247 3300032005 Bacteria 605
87 Ga0307415_100787112 3300032126 Bacteria 867
88 Ga0307415_101060738 3300032126 Bacteria 756
89 Ga0439438_177259 3300041405 Bacteria 507
90 Ga0439465_0023031 3300041413 Bacteria 1959
91 Ga0451787_383157 3300041441 Bacteria 938
92 Ga0451791_0383973 3300041451 Bacteria 1909
93 Ga0451791_1302546 3300041451 Bacteria 2250
94 Ga0451797_0088921 3300041453 Bacteria 570
95 Ga0451795_1192807 3300041456 Bacteria 669
96 Ga0451802_1276863 3300041460 Bacteria 927
97 Ga0451802_1849615 3300041460 Bacteria 1293
98 Ga0451804_0815809 3300041463 Bacteria 652
99 Ga0451807_0712539 3300041486 Bacteria 586
100 Ga0451833_0488462 3300041491 Bacteria 697
101 Ga0451837_0389177 3300041494 Bacteria 872
102 Ga0451841_0363710 3300041498 Bacteria 796
103 Ga0451853_0725260 3300041512 Bacteria 999
104 Ga0495638_0086473 3300046460 Bacteria 1895
105 Ga0495638_0261332 3300046460 Bacteria 949
106 Ga0495620_0038531 3300046515 Bacteria 2121
107 Ga0495671_0278622 3300046692 Bacteria 806
108 Ga0495615_0022304 3300048090 Bacteria 1439
109 Ga0496105_0439612 3300048908 Bacteria 1031
110 Ga0496109_1115651 3300048912 Bacteria 726
111 Ga0496110_0180700 3300048913 Bacteria 1916
112 Ga0496111_1045125 3300048914 Bacteria 584
113 Ga0496113_0821481 3300048916 Bacteria 738
114 Ga0496119_0281920 3300048922 Bacteria 826
115 Ga0496122_0000744 3300048925 Bacteria 63598
116 Ga0496123_0000172 3300048926 Bacteria 130598
117 Ga0496124_0000656 3300048927 Bacteria 57087
118 Ga0496124_0305722 3300048927 Bacteria 1146
119 Ga0496125_0003372 3300048928 Bacteria 19463
120 Ga0501217_221739 3300049661 Bacteria 598
121 Ga0500650_0005686 3300053098 Bacteria 4680
122 Ga0500573_0017899 3300053140 Bacteria 4037
123 Ga0500573_0085454 3300053140 Bacteria 1789
124 Ga0500577_0018864 3300053142 Bacteria 2225
125 Ga0500577_0036323 3300053142 Bacteria 1763
126 Ga0500577_0239304 3300053142 Bacteria 788
127 Ga0500645_007050 3300053730 Bacteria 3948
128 2501940148 2501939600 Bacteria 6907073
129 2515497030 2515154088 Bacteria 5526283
130 2516088277 2515154203 Bacteria 5458536
131 2643876118 2643221572 Bacteria 3614809
132 2644112985 2643221619 Bacteria 4158469
133 2644383173 2643221669 Bacteria 3611286
134 2644505882 2643221690 Bacteria 4654705
135 2644524291 2643221694 Bacteria 4392972
136 2644668391 2643221722 Bacteria 4247614
137 2676492357 2675903060 Bacteria 10051191
138 2808899833 2808606372 Bacteria 4649509
139 2855686677 2855683550 Bacteria 7134265
140 2856863430 2856858025 Bacteria 7255264
141 2857739705 2857737099 Bacteria 3104305
142 2862996415 2862993130 Bacteria 3860849
143 2867511403 2867507094 Bacteria 6506033
144 2919444616 2919443155 Bacteria 4072969
145 2939659815 2939657138 Bacteria 3740283
146 2964328694 2964326757 Bacteria 3290868
147 649814805 649633069 Bacteria 6962533
148 8057348022 8057345674 Bacteria 4160394
149 Ga0157370_11678092
150 Ga0070658_10332799
151 Ga0068869_100799190
152 Ga0070668_100003772
153 Ga0070668_100182295
154 Ga0070668_100249474
155 Ga0070669_100232665
156 Ga0070673_100759934
157 Ga0070667_101229637
158 Ga0070700_101211154
159 Ga0070663_100969835
160 Ga0070678_100567752
161 Ga0068857_100460839
162 Ga0068854_102007983
163 Ga0068861_100209075
164 Ga0068870_10237724
165 Ga0068862_100175062
166 Ga0068865_100605874
167 Ga0105244_10081723
168 Ga0111539_10141152
169 Ga0105243_10234563
170 Ga0105243_10316711
171 Ga0105242_12297386
172 Ga0105246_10135984
173 Ga0105246_11047851
174 Ga0157370_10238642
175 Ga0157369_10067415
176 Ga0157375_10304653
177 Ga0157375_10362216
178 Ga0157375_11326421
179 Ga0163163_10307268
180 Ga0163163_11791916
181 Ga0157380_10009655
182 Ga0157379_10945719
183 Ga0163161_10234298
184 Ga0163161_10580555
185 Ga0163161_11164332
186 Ga0207688_10326316
187 Ga0207643_10217771
188 Ga0207643_10288897
189 Ga0207705_10307416
190 Ga0207681_10197920
191 Ga0207659_10283633
192 Ga0207709_10105326
193 Ga0207669_10971218
194 Ga0207704_10444948
195 Ga0207691_10087510
196 Ga0207651_10699637
197 Ga0207668_10002345
198 Ga0207668_11728597
199 Ga0207658_11080758
200 Ga0207678_10649862
201 Ga0207678_10818253
202 Ga0207708_10880916
203 Ga0207674_10726149
204 Ga0207675_100325151
205 Ga0207683_10279911
206 Ga0207683_10464039
207 Ga0207698_10587442
208 Ga0268266_10176478
209 Ga0268265_10144851
210 Ga0268265_11184827
211 Ga0307515_10000149
212 Ga0307516_10000682
213 Ga0307405_10277240
214 Ga0307405_10650726
215 Ga0307405_10822847
216 Ga0307413_10933711
217 Ga0307413_11051434
218 Ga0307413_11436073
219 Ga0307410_10123706
220 Ga0307406_10960130
221 Ga0307406_11083358
222 Ga0307412_10269912
223 Ga0307409_100195222
224 Ga0307409_100294374
225 Ga0307409_100655736
226 Ga0307409_100742503
227 Ga0307409_100996138
228 Ga0307409_101462081
229 Ga0307416_100692060
230 Ga0307416_102685972
231 Ga0307414_10183919
232 Ga0307414_11162593
233 Ga0307411_10657592
234 Ga0307411_11580247
235 Ga0307415_100787112
236 Ga0307415_101060738
237 Ga0439438_177259
238 Ga0439465_0023031
239 Ga0451787_383157
240 Ga0451791_0383973
241 Ga0451791_1302546
242 Ga0451797_0088921
243 Ga0451795_1192807
244 Ga0451802_1276863
245 Ga0451802_1849615
246 Ga0451804_0815809
247 Ga0451807_0712539
248 Ga0451833_0488462
249 Ga0451837_0389177
250 Ga0451841_0363710
251 Ga0451853_0725260
252 Ga0495638_0086473
253 Ga0495638_0261332
254 Ga0495620_0038531
255 Ga0495671_0278622
256 Ga0495615_0022304
257 Ga0496105_0439612
258 Ga0496109_1115651
259 Ga0496110_0180700
260 Ga0496111_1045125
261 Ga0496113_0821481
262 Ga0496119_0281920
263 Ga0496122_0000744
264 Ga0496123_0000172
265 Ga0496124_0000656
266 Ga0496124_0305722
267 Ga0496125_0003372
268 Ga0501217_221739
269 Ga0500650_0005686
270 Ga0500573_0017899
271 Ga0500573_0085454
272 Ga0500577_0018864
273 Ga0500577_0036323
274 Ga0500577_0239304
275 Ga0500645_007050
276 2501940148
277 2515497030
278 2516088277
279 2643876118
280 2644112985
281 2644383173
282 2644505882
283 2644524291
284 2644668391
285 2676492357
286 2808899833
287 2855686677
288 2856863430
289 2857739705
290 2862996415
291 2867511403
292 2919444616
293 2939659815
294 2964328694
295 649814805
296 8057348022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

22

166

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8301 5 147
3otl-assembly1.cif.gz_B three-dimensional structure of the putative uncharacterized protein from rhizobium leguminosarum at the resolution 1.9a, northeast structural genomics consortium target rlr261 0.8234 3 148
3put-assembly1.cif.gz_A crystal structure of the cert start domain (mutant v151e) from rhizobium etli at the resolution 1.8a, northeast structural genomics consortium target rer239. 0.8218 3 149
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8194 5 146
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8191 5 146
ID Description Score Start End Superfamily
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8331 8 149 3.30.530.20
3putA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8144 3 149 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8085 3 149 3.30.530.20
3q64A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.807 4 150 3.30.530.20
af_Q55DB6_248_379_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8009 4 147 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7X0KEK7-F1-model_v4 deleted 0.9984 21 150
AF-A0A1H1WXY2-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9956 1 148
AF-A0A3T1B2D9-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9882 6 150
AF-A0A4R0GM25-F1-model_v4 SRPBCC domain-containing protein 0.9783 1 147
AF-A0A2W2E8B1-F1-model_v4 ATPase 0.9783 2 150

Map