F202573

General Info

Members Datasets Scaffolds Average Seq Length
148 99 296 258

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100195219|Ga0070707_1001952192
Length 259
Sequence MRPGRLAVVLATVLLAGCMPGEIPSPTPLTASLNPTGVPAKPSPVQLTVFGASSLKAALDKVKAEYEAANPGNTLTVALDASSTLETQIEQGAPADVFLSADTRNPQKLIDGGFATEPLVIFASNKLTVIVPKDNPAGIESPADLARSGVDIVAAGDEVPITKYADQLVVSREENVKAIVGKIELGQGDAGIVYVTDAAASKGIATVDVPADANVLATYGGVFVKSSKHEADARAFLAWIGGPSGQAILVEFGFLPPPP

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
44 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
45 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
52 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
53 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
54 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
55 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
56 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
57 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
58 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
59 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
60 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
61 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
62 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
63 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
64 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
65 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
66 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
67 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
68 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
82 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
93 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
94 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
95 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
96 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.78
Rhizosphere 91.22
Stem 0
Stem Tuber 0
Unclassified 12.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100195219 3300005468 Bacteria 1974
2 Ga0068869_100281004 3300005334 Bacteria 1338
3 Ga0068869_100498584 3300005334 Unclassified 1016
4 Ga0070680_100000001 3300005336 Bacteria 276263
5 Ga0070680_100306827 3300005336 Bacteria 1346
6 Ga0070674_100018983 3300005356 Bacteria 4360
7 Ga0070673_100295325 3300005364 Bacteria 1425
8 Ga0070673_100609422 3300005364 Bacteria 996
9 Ga0070705_100080926 3300005440 Bacteria 1994
10 Ga0070705_100269615 3300005440 Unclassified 1205
11 Ga0070705_100383511 3300005440 Bacteria 1035
12 Ga0070708_100030260 3300005445 Bacteria 4679
13 Ga0070708_100287142 3300005445 Bacteria 1549
14 Ga0070706_100058423 3300005467 Bacteria 3559
15 Ga0070706_100177292 3300005467 Bacteria 1990
16 Ga0070707_100054093 3300005468 Bacteria 3848
17 Ga0070699_100015010 3300005518 Bacteria 6657
18 Ga0070699_100089361 3300005518 Bacteria 2692
19 Ga0070699_100116034 3300005518 Unclassified 2353
20 Ga0070699_100246322 3300005518 Bacteria 1596
21 Ga0070684_100021736 3300005535 Bacteria 5344
22 Ga0070697_100021847 3300005536 Bacteria 5073
23 Ga0070695_100145660 3300005545 Bacteria 1647
24 Ga0070696_100039444 3300005546 Bacteria 3261
25 Ga0070696_100100764 3300005546 Bacteria 2070
26 Ga0070696_100161605 3300005546 Bacteria 1650
27 Ga0070696_100199673 3300005546 Unclassified 1492
28 Ga0070704_100004588 3300005549 Bacteria 7988
29 Ga0081539_10008731 3300005985 Bacteria 8709
30 Ga0068871_100745400 3300006358 Bacteria 900
31 Ga0075433_10002933 3300006852 Bacteria 13092
32 Ga0075435_100258297 3300007076 Bacteria 1484
33 Ga0111539_10102369 3300009094 Bacteria 3361
34 Ga0105245_10884504 3300009098 Bacteria 934
35 Ga0105243_10113363 3300009148 Unclassified 2273
36 Ga0105243_10287726 3300009148 Unclassified 1483
37 Ga0105242_10186868 3300009176 Bacteria 1832
38 Ga0105248_10637755 3300009177 Unclassified 1202
39 Ga0105248_10674982 3300009177 Bacteria 1166
40 Ga0105249_10295415 3300009553 Bacteria 1623
41 Ga0105249_10548914 3300009553 Bacteria 1206
42 Ga0105239_10379707 3300010375 Unclassified 1597
43 Ga0105239_10527537 3300010375 Bacteria 1344
44 Ga0105246_10193711 3300011119 Bacteria 1575
45 Ga0157378_10636535 3300013297 Unclassified 1081
46 Ga0157375_10246500 3300013308 Bacteria 1947
47 Ga0163163_10169036 3300014325 Bacteria 2233
48 Ga0157380_10376377 3300014326 Bacteria 1338
49 Ga0207684_10019183 3300025910 Bacteria 5850
50 Ga0207660_10000001 3300025917 Bacteria 1034169
51 Ga0207646_10049372 3300025922 Bacteria 3769
52 Ga0207646_10161688 3300025922 Bacteria 2021
53 Ga0207687_10105751 3300025927 Bacteria 2079
54 Ga0207706_10170741 3300025933 Bacteria 1911
55 Ga0207706_10258109 3300025933 Bacteria 1522
56 Ga0207686_10028088 3300025934 Bacteria 3303
57 Ga0207669_10010211 3300025937 Bacteria 4512
58 Ga0207689_10142741 3300025942 Bacteria 1973
59 Ga0207689_10430766 3300025942 Unclassified 1101
60 Ga0207712_10451527 3300025961 Unclassified 1090
61 Ga0207640_10178334 3300025981 Bacteria 1591
62 Ga0207676_10071135 3300026095 Bacteria 2792
63 Ga0207683_10268155 3300026121 Bacteria 1559
64 Ga0207683_10348179 3300026121 Bacteria 1359
65 Ga0265326_10009395 3300028558 Bacteria 2924
66 Ga0265319_1009583 3300028563 Bacteria 4112
67 Ga0265334_10093503 3300028573 Unclassified 1095
68 Ga0265322_10012027 3300028654 Bacteria 2504
69 Ga0265336_10084552 3300028666 Bacteria 946
70 Ga0265316_10005283 3300031344 Bacteria 12602
71 Ga0307407_10200590 3300031903 Bacteria 1337
72 Ga0307416_100165063 3300032002 Bacteria 2053
73 Ga0451577_0138271 3300042876 Bacteria 2188
74 Ga0495629_0195799 3300046459 Bacteria 1398
75 Ga0495628_0230110 3300046516 Unclassified 1390
76 Ga0495652_0150927 3300046529 Bacteria 1816
77 Ga0495634_0332553 3300046642 Bacteria 913
78 Ga0495674_0833981 3300047319 Bacteria 715
79 Ga0495680_0023056 3300047322 Bacteria 5181
80 Ga0495684_0088578 3300047471 Bacteria 2346
81 Ga0496101_0167071 3300048904 Bacteria 1690
82 Ga0496102_0006996 3300048905 Bacteria 9629
83 Ga0496103_0001239 3300048906 Bacteria 17415
84 Ga0496104_0162403 3300048907 Bacteria 2143
85 Ga0496107_0015919 3300048910 Bacteria 5276
86 Ga0496107_0116766 3300048910 Bacteria 1965
87 Ga0496109_0048433 3300048912 Bacteria 3867
88 Ga0496109_0103167 3300048912 Bacteria 2647
89 Ga0496109_0640195 3300048912 Bacteria 1000
90 Ga0496112_0000005 3300048915 Bacteria 525541
91 Ga0496113_0079482 3300048916 Bacteria 2511
92 Ga0496114_0081310 3300048917 Bacteria 2737
93 Ga0496114_0189064 3300048917 Bacteria 1801
94 Ga0501031_0081384 3300049568 Bacteria 2111
95 Ga0501032_0177791 3300049569 Bacteria 1394
96 Ga0501033_0156724 3300049570 Bacteria 1640
97 Ga0501036_0098051 3300049572 Bacteria 2478
98 Ga0501036_0169686 3300049572 Bacteria 1838
99 Ga0501037_0190470 3300049573 Bacteria 1452
100 Ga0501038_0037802 3300049574 Bacteria 4231
101 Ga0501039_0155297 3300049575 Bacteria 1798
102 Ga0501039_0185571 3300049575 Bacteria 1636
103 Ga0501040_0062746 3300049576 Bacteria 2556
104 Ga0501040_0337778 3300049576 Bacteria 1078
105 Ga0501041_0310228 3300049577 Bacteria 994
106 Ga0501042_0214723 3300049578 Bacteria 1387
107 Ga0501043_0140836 3300049579 Bacteria 1889
108 Ga0501046_0092984 3300049580 Bacteria 2318
109 Ga0501048_0079467 3300049582 Bacteria 2314
110 Ga0501068_0039711 3300049584 Bacteria 2823
111 Ga0501069_0102792 3300049585 Bacteria 1623
112 Ga0501071_0156159 3300049587 Bacteria 1703
113 Ga0501072_0076394 3300049588 Bacteria 2650
114 Ga0501072_0089385 3300049588 Bacteria 2445
115 Ga0501072_0172490 3300049588 Bacteria 1726
116 Ga0501072_0281190 3300049588 Bacteria 1323
117 Ga0501074_0070575 3300049590 Bacteria 2511
118 Ga0501074_0152632 3300049590 Bacteria 1651
119 Ga0501075_0092954 3300049591 Bacteria 2290
120 Ga0501075_0312211 3300049591 Unclassified 1198
121 Ga0501076_0034289 3300049592 Bacteria 3966
122 Ga0501076_0101706 3300049592 Bacteria 2316
123 Ga0501076_0126598 3300049592 Bacteria 2070
124 Ga0501076_0213532 3300049592 Bacteria 1577
125 Ga0501079_0004193 3300049741 Bacteria 10687
126 Ga0501079_0179823 3300049741 Bacteria 1650
127 Ga0501080_0032368 3300049742 Bacteria 4876
128 Ga0501080_0047367 3300049742 Bacteria 4002
129 Ga0501080_0276187 3300049742 Bacteria 1528
130 Ga0501081_0022740 3300049743 Bacteria 4196
131 Ga0501081_0106974 3300049743 Bacteria 1983
132 Ga0501081_0229689 3300049743 Unclassified 1351
133 Ga0501035_0311746 3300049822 Bacteria 1324
134 Ga0501045_0018964 3300049824 Bacteria 4899
135 nmdc:mga0n895_108999_c1 3300050512 Bacteria 2784
136 nmdc:mga0a205_8173_c1 3300050515 Bacteria 9506
137 Ga0495601_0032362 3300053077 Bacteria 3255
138 Ga0495601_0163096 3300053077 Unclassified 1457
139 Ga0495619_0010605 3300053085 Bacteria 5797
140 Ga0495619_0017078 3300053085 Bacteria 4601
141 Ga0501084_0045005 3300054114 Bacteria 3696
142 Ga0501084_0064874 3300054114 Bacteria 3055
143 Ga0501084_0109678 3300054114 Bacteria 2319
144 Ga0501084_0287123 3300054114 Unclassified 1389
145 Ga0501082_0116233 3300060353 Bacteria 2316
146 Ga0501082_0170276 3300060353 Bacteria 1893
147 Ga0530510_0080182 3300061734 Bacteria 2375
148 Ga0530510_0236672 3300061734 Unclassified 1359
149 Ga0070707_100195219
150 Ga0068869_100281004
151 Ga0068869_100498584
152 Ga0070680_100000001
153 Ga0070680_100306827
154 Ga0070674_100018983
155 Ga0070673_100295325
156 Ga0070673_100609422
157 Ga0070705_100080926
158 Ga0070705_100269615
159 Ga0070705_100383511
160 Ga0070708_100030260
161 Ga0070708_100287142
162 Ga0070706_100058423
163 Ga0070706_100177292
164 Ga0070707_100054093
165 Ga0070699_100015010
166 Ga0070699_100089361
167 Ga0070699_100116034
168 Ga0070699_100246322
169 Ga0070684_100021736
170 Ga0070697_100021847
171 Ga0070695_100145660
172 Ga0070696_100039444
173 Ga0070696_100100764
174 Ga0070696_100161605
175 Ga0070696_100199673
176 Ga0070704_100004588
177 Ga0081539_10008731
178 Ga0068871_100745400
179 Ga0075433_10002933
180 Ga0075435_100258297
181 Ga0111539_10102369
182 Ga0105245_10884504
183 Ga0105243_10113363
184 Ga0105243_10287726
185 Ga0105242_10186868
186 Ga0105248_10637755
187 Ga0105248_10674982
188 Ga0105249_10295415
189 Ga0105249_10548914
190 Ga0105239_10379707
191 Ga0105239_10527537
192 Ga0105246_10193711
193 Ga0157378_10636535
194 Ga0157375_10246500
195 Ga0163163_10169036
196 Ga0157380_10376377
197 Ga0207684_10019183
198 Ga0207660_10000001
199 Ga0207646_10049372
200 Ga0207646_10161688
201 Ga0207687_10105751
202 Ga0207706_10170741
203 Ga0207706_10258109
204 Ga0207686_10028088
205 Ga0207669_10010211
206 Ga0207689_10142741
207 Ga0207689_10430766
208 Ga0207712_10451527
209 Ga0207640_10178334
210 Ga0207676_10071135
211 Ga0207683_10268155
212 Ga0207683_10348179
213 Ga0265326_10009395
214 Ga0265319_1009583
215 Ga0265334_10093503
216 Ga0265322_10012027
217 Ga0265336_10084552
218 Ga0265316_10005283
219 Ga0307407_10200590
220 Ga0307416_100165063
221 Ga0451577_0138271
222 Ga0495629_0195799
223 Ga0495628_0230110
224 Ga0495652_0150927
225 Ga0495634_0332553
226 Ga0495674_0833981
227 Ga0495680_0023056
228 Ga0495684_0088578
229 Ga0496101_0167071
230 Ga0496102_0006996
231 Ga0496103_0001239
232 Ga0496104_0162403
233 Ga0496107_0015919
234 Ga0496107_0116766
235 Ga0496109_0048433
236 Ga0496109_0103167
237 Ga0496109_0640195
238 Ga0496112_0000005
239 Ga0496113_0079482
240 Ga0496114_0081310
241 Ga0496114_0189064
242 Ga0501031_0081384
243 Ga0501032_0177791
244 Ga0501033_0156724
245 Ga0501036_0098051
246 Ga0501036_0169686
247 Ga0501037_0190470
248 Ga0501038_0037802
249 Ga0501039_0155297
250 Ga0501039_0185571
251 Ga0501040_0062746
252 Ga0501040_0337778
253 Ga0501041_0310228
254 Ga0501042_0214723
255 Ga0501043_0140836
256 Ga0501046_0092984
257 Ga0501048_0079467
258 Ga0501068_0039711
259 Ga0501069_0102792
260 Ga0501071_0156159
261 Ga0501072_0076394
262 Ga0501072_0089385
263 Ga0501072_0172490
264 Ga0501072_0281190
265 Ga0501074_0070575
266 Ga0501074_0152632
267 Ga0501075_0092954
268 Ga0501075_0312211
269 Ga0501076_0034289
270 Ga0501076_0101706
271 Ga0501076_0126598
272 Ga0501076_0213532
273 Ga0501079_0004193
274 Ga0501079_0179823
275 Ga0501080_0032368
276 Ga0501080_0047367
277 Ga0501080_0276187
278 Ga0501081_0022740
279 Ga0501081_0106974
280 Ga0501081_0229689
281 Ga0501035_0311746
282 Ga0501045_0018964
283 nmdc:mga0n895_108999_c1
284 nmdc:mga0a205_8173_c1
285 Ga0495601_0032362
286 Ga0495601_0163096
287 Ga0495619_0010605
288 Ga0495619_0017078
289 Ga0501084_0045005
290 Ga0501084_0064874
291 Ga0501084_0109678
292 Ga0501084_0287123
293 Ga0501082_0116233
294 Ga0501082_0170276
295 Ga0530510_0080182
296 Ga0530510_0236672

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

47

255

0.93

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

52

247

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.9304 15 249
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.9226 15 249
3k6v-assembly1.cif.gz_A m. acetivorans molybdate-binding protein (moda) in citrate-bound open form 0.882 16 247
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.8742 17 247
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.8696 16 247
ID Description Score Start End Superfamily
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9829 17 82 3.40.190.10
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9659 19 83 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9546 17 82 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9384 19 81 3.40.190.10
af_P16700_28_100_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9343 17 81 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2N0AJ44-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9721 14 90 GO:0015689
GO:0030973
AF-A0A443G2R9-F1-model_v4 deleted 0.9609 14 83
AF-A0A0D2JUF4-F1-model_v4 Molybdenum ABC transporter substrate-binding protein 0.942 17 249 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-A0A4P5XH14-F1-model_v4 deleted 0.9408 20 247
AF-A0A0D2JUF4-F1-model_v4 Molybdenum ABC transporter substrate-binding protein 0.938 17 249 GO:0015689
GO:0030288
GO:0030973
GO:0046872

Map