F202274

General Info

Members Datasets Scaffolds Average Seq Length
148 104 296 227

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10369653|Ga0070666_103696531
Length 253
Sequence MYSLRSPCLGVLAVNDVPNELKNMSREPEQLSIEVGEYGAVTALLYAAPKKNRAGITLILGHGAGGNQLSAFLRMAANGLADRGLDVLTFNFLYSERGRGAPDPKPKLEACYQAVIYAALRERKLKGNKLAIGGKSMGGRIGSQVAAMPHAGEIAALVFLGYPLHPPGNLEKMRDAHLKDIKAPMLFLQGSRDAFGTTDEIRSVIKKHKLPATLYAIEGGDHSFKVPKSAGPQEKVYESVMDEIARWLVTSLS

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
98 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
99 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
100 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
101 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
104 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 0
Rhizoplane 2.7
Rhizosphere 87.84
Stem 0
Stem Tuber 0
Unclassified 22.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10369653 3300005335 Unclassified 1028
2 JGI24748J21848_1000059 3300002074 Bacteria 45110
3 JGI24034J26672_10000030 3300002239 Bacteria 97515
4 Ga0065715_10002128 3300005293 Bacteria 9288
5 Ga0065707_10150086 3300005295 Unclassified 1668
6 Ga0070670_100141953 3300005331 Bacteria 2077
7 Ga0070687_100040242 3300005343 Bacteria 2354
8 Ga0070669_100641119 3300005353 Bacteria 893
9 Ga0070671_100033561 3300005355 Bacteria 4246
10 Ga0070703_10000057 3300005406 Bacteria 55145
11 Ga0070709_10000031 3300005434 Bacteria 117654
12 Ga0070709_10240087 3300005434 Bacteria 1301
13 Ga0070709_10459435 3300005434 Bacteria 960
14 Ga0070714_100010237 3300005435 Bacteria 7403
15 Ga0070714_100672064 3300005435 Bacteria 998
16 Ga0070713_100032130 3300005436 Bacteria 4189
17 Ga0070701_10073352 3300005438 Unclassified 1835
18 Ga0070711_100214442 3300005439 Bacteria 1493
19 Ga0070705_100000019 3300005440 Bacteria 84475
20 Ga0070694_100103274 3300005444 Bacteria 2019
21 Ga0070694_100625931 3300005444 Bacteria 869
22 Ga0070708_100079027 3300005445 Bacteria 2975
23 Ga0070706_100000390 3300005467 Bacteria 52750
24 Ga0070706_100003564 3300005467 Bacteria 15294
25 Ga0070706_100015582 3300005467 Bacteria 7021
26 Ga0070706_100119985 3300005467 Bacteria 2451
27 Ga0070707_100319068 3300005468 Bacteria 1510
28 Ga0070698_100020644 3300005471 Bacteria 6906
29 Ga0070698_100217166 3300005471 Unclassified 1846
30 Ga0070698_100399846 3300005471 Bacteria 1307
31 Ga0070699_100000004 3300005518 Bacteria 404262
32 Ga0070697_100000073 3300005536 Bacteria 79804
33 Ga0070697_100012992 3300005536 Bacteria 6526
34 Ga0070686_100019217 3300005544 Unclassified 4022
35 Ga0070695_100010854 3300005545 Bacteria 5442
36 Ga0070696_100000072 3300005546 Bacteria 49124
37 Ga0070696_100008918 3300005546 Bacteria 6712
38 Ga0070696_100515155 3300005546 Bacteria 954
39 Ga0070693_100002454 3300005547 Bacteria 8543
40 Ga0070704_100111844 3300005549 Unclassified 2080
41 Ga0070704_100114039 3300005549 Bacteria 2062
42 Ga0070704_100290788 3300005549 Bacteria 1358
43 Ga0068857_100282441 3300005577 Bacteria 1527
44 Ga0068864_100167708 3300005618 Unclassified 2000
45 Ga0068861_100264843 3300005719 Unclassified 1473
46 Ga0068858_100000550 3300005842 Bacteria 39088
47 Ga0068860_100663342 3300005843 Bacteria 1051
48 Ga0068862_100307473 3300005844 Unclassified 1460
49 Ga0070717_10000919 3300006028 Bacteria 19590
50 Ga0070717_10078622 3300006028 Bacteria 2764
51 Ga0070717_10148388 3300006028 Bacteria 2027
52 Ga0075368_10036593 3300006042 Bacteria 1917
53 Ga0075363_100452808 3300006048 Unclassified 758
54 Ga0070712_100062551 3300006175 Bacteria 2632
55 Ga0070712_100076298 3300006175 Bacteria 2413
56 Ga0070712_100125237 3300006175 Bacteria 1940
57 Ga0070712_100290560 3300006175 Unclassified 1320
58 Ga0075366_10075431 3300006195 Unclassified 2012
59 Ga0075428_100005807 3300006844 Bacteria 13708
60 Ga0075433_10701841 3300006852 Bacteria 886
61 Ga0075434_100216968 3300006871 Bacteria 1933
62 Ga0075429_100190897 3300006880 Bacteria 1795
63 Ga0075436_100108319 3300006914 Bacteria 1938
64 Ga0111539_10043785 3300009094 Bacteria 5365
65 Ga0105247_10000552 3300009101 Bacteria 30429
66 Ga0114129_10053184 3300009147 Bacteria 5679
67 Ga0114129_10243912 3300009147 Bacteria 2414
68 Ga0114129_10393666 3300009147 Bacteria 1827
69 Ga0114129_11294650 3300009147 Unclassified 904
70 Ga0105242_10592121 3300009176 Unclassified 1070
71 Ga0105248_10255992 3300009177 Unclassified 1971
72 Ga0105249_10324079 3300009553 Unclassified 1552
73 Ga0099796_10049907 3300010159 Unclassified 1449
74 Ga0105246_10324892 3300011119 Unclassified 1252
75 Ga0105246_10459273 3300011119 Bacteria 1072
76 Ga0157378_10027742 3300013297 Unclassified 4994
77 Ga0157380_10012332 3300014326 Bacteria 6200
78 Ga0157380_10084503 3300014326 Plasmid 2603
79 Ga0157380_10149050 3300014326 Bacteria 2020
80 Ga0157380_10432122 3300014326 Bacteria 1259
81 Ga0157380_10951365 3300014326 Unclassified 889
82 Ga0213874_10033767 3300021377 Unclassified 1494
83 Ga0213876_10053155 3300021384 Bacteria 2140
84 Ga0207653_10000277 3300025885 Bacteria 30318
85 Ga0207692_10005977 3300025898 Bacteria 4916
86 Ga0207710_10000001 3300025900 Bacteria 1797433
87 Ga0207680_10511639 3300025903 Unclassified 856
88 Ga0207699_10000012 3300025906 Bacteria 278800
89 Ga0207684_10000465 3300025910 Bacteria 52508
90 Ga0207684_10034545 3300025910 Bacteria 4296
91 Ga0207684_10035147 3300025910 Unclassified 4256
92 Ga0207693_10001504 3300025915 Bacteria 20577
93 Ga0207693_10017345 3300025915 Bacteria 5742
94 Ga0207693_10129716 3300025915 Bacteria 1982
95 Ga0207663_10005041 3300025916 Bacteria 6630
96 Ga0207663_10533534 3300025916 Bacteria 915
97 Ga0207662_10062962 3300025918 Bacteria 2230
98 Ga0207646_10316263 3300025922 Bacteria 1411
99 Ga0207646_10601833 3300025922 Bacteria 987
100 Ga0207700_10047170 3300025928 Bacteria 3192
101 Ga0207700_10304000 3300025928 Bacteria 1378
102 Ga0207700_10716266 3300025928 Unclassified 894
103 Ga0207664_10036490 3300025929 Bacteria 3800
104 Ga0207664_10294827 3300025929 Bacteria 1426
105 Ga0207644_10000150 3300025931 Bacteria 50157
106 Ga0207706_10198834 3300025933 Unclassified 1758
107 Ga0207665_10080905 3300025939 Unclassified 2235
108 Ga0207689_10003180 3300025942 Bacteria 15062
109 Ga0207703_10000347 3300026035 Bacteria 49743
110 Ga0207674_10335530 3300026116 Unclassified 1462
111 Ga0207674_10477825 3300026116 Bacteria 1204
112 Ga0207675_100309216 3300026118 Bacteria 1541
113 Ga0207675_100400723 3300026118 Unclassified 1352
114 Ga0207675_100467528 3300026118 Bacteria 1252
115 Ga0209813_10023354 3300027866 Bacteria 1758
116 Ga0207428_10543385 3300027907 Bacteria 841
117 Ga0268265_10216521 3300028380 Unclassified 1673
118 Ga0436365_1229284 3300039437 Bacteria 1758
119 Ga0436365_1480568 3300039437 Bacteria 5137
120 Ga0436365_1787706 3300039437 Bacteria 1440
121 Ga0436360_0557616 3300039438 Unclassified 902
122 Ga0436361_0664268 3300039447 Bacteria 3015
123 Ga0436363_0238985 3300039450 Bacteria 4657
124 Ga0436363_0403556 3300039450 Bacteria 4229
125 Ga0436362_0858023 3300039453 Bacteria 1531
126 Ga0453683_0431805 3300044673 Unclassified 851
127 Ga0451576_0009811 3300045051 Bacteria 11064
128 Ga0495663_0000555 3300046525 Bacteria 13161
129 Ga0495640_0295483 3300046533 Bacteria 1007
130 Ga0495672_0227643 3300047320 Bacteria 917
131 Ga0495602_0313452 3300048088 Unclassified 1144
132 Ga0496100_0364752 3300048903 Bacteria 1094
133 Ga0496104_0413046 3300048907 Bacteria 1262
134 Ga0496105_0261387 3300048908 Bacteria 1400
135 Ga0496112_0054394 3300048915 Bacteria 3933
136 nmdc:mga0k408_32210_c1 3300050493 Bacteria 2572
137 nmdc:mga06z11_190976_c1 3300050494 Bacteria 1186
138 nmdc:mga05p37_129072_c1 3300050507 Bacteria 3103
139 nmdc:mga05p37_60_c1 3300050507 Bacteria 95299
140 nmdc:mga0n895_55345_c1 3300050512 Bacteria 3904
141 nmdc:mga0rr50_196544_c1 3300050513 Bacteria 1655
142 nmdc:mga0rr50_266560_c1 3300050513 Bacteria 1426
143 Ga0495601_0041227 3300053077 Bacteria 2893
144 Ga0495595_0026384 3300053084 Bacteria 2581
145 Ga0495619_0037279 3300053085 Bacteria 3166
146 Ga0501082_0844049 3300060353 Unclassified 801
147 2809227747 2808606447 Bacteria 3572005
148 2852634502 2852632344 Bacteria 3463163
149 Ga0070666_10369653
150 JGI24748J21848_1000059
151 JGI24034J26672_10000030
152 Ga0065715_10002128
153 Ga0065707_10150086
154 Ga0070670_100141953
155 Ga0070687_100040242
156 Ga0070669_100641119
157 Ga0070671_100033561
158 Ga0070703_10000057
159 Ga0070709_10000031
160 Ga0070709_10240087
161 Ga0070709_10459435
162 Ga0070714_100010237
163 Ga0070714_100672064
164 Ga0070713_100032130
165 Ga0070701_10073352
166 Ga0070711_100214442
167 Ga0070705_100000019
168 Ga0070694_100103274
169 Ga0070694_100625931
170 Ga0070708_100079027
171 Ga0070706_100000390
172 Ga0070706_100003564
173 Ga0070706_100015582
174 Ga0070706_100119985
175 Ga0070707_100319068
176 Ga0070698_100020644
177 Ga0070698_100217166
178 Ga0070698_100399846
179 Ga0070699_100000004
180 Ga0070697_100000073
181 Ga0070697_100012992
182 Ga0070686_100019217
183 Ga0070695_100010854
184 Ga0070696_100000072
185 Ga0070696_100008918
186 Ga0070696_100515155
187 Ga0070693_100002454
188 Ga0070704_100111844
189 Ga0070704_100114039
190 Ga0070704_100290788
191 Ga0068857_100282441
192 Ga0068864_100167708
193 Ga0068861_100264843
194 Ga0068858_100000550
195 Ga0068860_100663342
196 Ga0068862_100307473
197 Ga0070717_10000919
198 Ga0070717_10078622
199 Ga0070717_10148388
200 Ga0075368_10036593
201 Ga0075363_100452808
202 Ga0070712_100062551
203 Ga0070712_100076298
204 Ga0070712_100125237
205 Ga0070712_100290560
206 Ga0075366_10075431
207 Ga0075428_100005807
208 Ga0075433_10701841
209 Ga0075434_100216968
210 Ga0075429_100190897
211 Ga0075436_100108319
212 Ga0111539_10043785
213 Ga0105247_10000552
214 Ga0114129_10053184
215 Ga0114129_10243912
216 Ga0114129_10393666
217 Ga0114129_11294650
218 Ga0105242_10592121
219 Ga0105248_10255992
220 Ga0105249_10324079
221 Ga0099796_10049907
222 Ga0105246_10324892
223 Ga0105246_10459273
224 Ga0157378_10027742
225 Ga0157380_10012332
226 Ga0157380_10084503
227 Ga0157380_10149050
228 Ga0157380_10432122
229 Ga0157380_10951365
230 Ga0213874_10033767
231 Ga0213876_10053155
232 Ga0207653_10000277
233 Ga0207692_10005977
234 Ga0207710_10000001
235 Ga0207680_10511639
236 Ga0207699_10000012
237 Ga0207684_10000465
238 Ga0207684_10034545
239 Ga0207684_10035147
240 Ga0207693_10001504
241 Ga0207693_10017345
242 Ga0207693_10129716
243 Ga0207663_10005041
244 Ga0207663_10533534
245 Ga0207662_10062962
246 Ga0207646_10316263
247 Ga0207646_10601833
248 Ga0207700_10047170
249 Ga0207700_10304000
250 Ga0207700_10716266
251 Ga0207664_10036490
252 Ga0207664_10294827
253 Ga0207644_10000150
254 Ga0207706_10198834
255 Ga0207665_10080905
256 Ga0207689_10003180
257 Ga0207703_10000347
258 Ga0207674_10335530
259 Ga0207674_10477825
260 Ga0207675_100309216
261 Ga0207675_100400723
262 Ga0207675_100467528
263 Ga0209813_10023354
264 Ga0207428_10543385
265 Ga0268265_10216521
266 Ga0436365_1229284
267 Ga0436365_1480568
268 Ga0436365_1787706
269 Ga0436360_0557616
270 Ga0436361_0664268
271 Ga0436363_0238985
272 Ga0436363_0403556
273 Ga0436362_0858023
274 Ga0453683_0431805
275 Ga0451576_0009811
276 Ga0495663_0000555
277 Ga0495640_0295483
278 Ga0495672_0227643
279 Ga0495602_0313452
280 Ga0496100_0364752
281 Ga0496104_0413046
282 Ga0496105_0261387
283 Ga0496112_0054394
284 nmdc:mga0k408_32210_c1
285 nmdc:mga06z11_190976_c1
286 nmdc:mga05p37_129072_c1
287 nmdc:mga05p37_60_c1
288 nmdc:mga0n895_55345_c1
289 nmdc:mga0rr50_196544_c1
290 nmdc:mga0rr50_266560_c1
291 Ga0495601_0041227
292 Ga0495595_0026384
293 Ga0495619_0037279
294 Ga0501082_0844049
295 2809227747
296 2852634502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

54

249

0.91

PF01738

DLH

Dienelactone hydrolase family

43

252

0.88

PF12695

Abhydrolase_5

Alpha/beta hydrolase family

116

234

0.8

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

56

214

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.8426 1 220
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.8195 4 225
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.8136 1 220
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.7983 4 225
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.7955 4 225
ID Description Score Start End Superfamily
af_Q5JUR7_11_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8778 12 212 3.40.50.1820
af_A0A2R8RQ35_2_224_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8708 4 227 3.40.50.1820
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8627 18 221 3.40.50.1820
af_Q5JUR7_11_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8608 12 212 3.40.50.1820
af_A0A2R8RQ35_2_224_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.856 4 227 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3B9MLH3-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9912 1 125
AF-A0A2V8LXL1-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9893 1 226
AF-A0A3B9LV65-F1-model_v4 Dienelactone hydrolase 0.9822 1 222 GO:0016787
AF-A0A2V8LXL1-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9807 1 226
AF-A0A2V8PZX4-F1-model_v4 Alpha/beta hydrolase 0.9779 1 225 GO:0016787

Map