F201731

General Info

Members Datasets Scaffolds Average Seq Length
147 111 139 554

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0002144|Ga0500616_0002144_6986_8785
Length 599
Sequence LKKASGKITEKAGEKEFLKYNNSYPVIIYSYKNDFLTSHAKPKIFLALPIMTNQEIADIFDLLSKLMDIHGENSFKTKTYSTAAYRLEKLSSALAEMSPEQISSISGVGDAVTKKIQDILTTGKLPLLEEYLNKTPPGVVEMLAIKGIGPKKIAVLWKELGAESLGELEYACNENRLITLKGFGAKTQESILKSIAFMRNNMGFYLWAEAEAIALQVKNDLQTAFPDAKIEFTGEYRRQVPALASISFITDLADEQIRSAFELVPDTVFENEEHTLFVQIPNAPTLHFYKCQTQDFYLALFTGTSSPLFAEAFATQYTIPEQAESEEAIFAHNSLSFIPPALRESGDILTKAATNTIPELIQPGDIKGIIHSHSTWSDGVNTLEQMAIAARDKGYEYLVISDHSQAAFYANGLFPERIILQHAEIDMLNEKLAPFRIFKSIEADILHDGSLDYNAEVLSSFDLVIASVHSNLKMNEEKAMQRLLAAIQNPFTTILGHPTGRLLLSREGYPVDHKTLIDACVEHNVVIEINAHPRRLDLDWSWIPYALEKGAMLSVDPDAHSIKGMDLVKYGVYAAQKGGLTKERNLSSMGLAAFENFLK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
3 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
4 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
5 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
6 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
7 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
8 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
102 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
106 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
107 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
108 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
109 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
110 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
111 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 0
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.97
Nodule 0
Rhizoplane 2.72
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 JGI24740J21852_10002103 3300001979 Bacteria 9108
3 JGI24739J22299_10018751 3300001989 Bacteria 2483
4 JGI25154J39366_1000007 3300002738 Bacteria 335932
5 JGI25153J46596_10002940 3300003215 Bacteria 9642
6 rootL2_10088285 3300003322 Bacteria 4992
7 rootH1_10090389 3300003323 Bacteria 8106
8 rootH1_10102767 3300003323 Bacteria 3167
9 JGI25160J50197_1013928 3300003354 Bacteria 2716
10 Ga0055526_1016377 3300003771 Bacteria 2907
11 Ga0055528_1007321 3300003790 Bacteria 4896
12 Ga0055530_10003713 3300003791 Bacteria 8490
13 Ga0055531_10000085 3300003794 Bacteria 102372
14 Ga0065165_1000010 3300005262 Bacteria 323737
15 Ga0065704_10070140 3300005289 Bacteria 482257
16 Ga0070683_100005156 3300005329 Bacteria 10867
17 Ga0070666_10022716 3300005335 Bacteria 4077
18 Ga0068868_100114133 3300005338 Viruses 2198
19 Ga0070675_100031745 3300005354 Bacteria 4272
20 Ga0070673_100065818 3300005364 Bacteria 2892
21 Ga0070659_100005889 3300005366 Bacteria 8831
22 Ga0070663_100095681 3300005455 Bacteria 2208
23 Ga0070681_10009168 3300005458 Bacteria 9723
24 Ga0070681_10142199 3300005458 Bacteria 2329
25 Ga0068867_100007221 3300005459 Bacteria 7855
26 Ga0070679_100054498 3300005530 Bacteria 3981
27 Ga0068853_100016658 3300005539 Bacteria 6053
28 Ga0070665_100000442 3300005548 Bacteria 60619
29 Ga0068855_100000399 3300005563 Bacteria 53597
30 Ga0068855_100005141 3300005563 Bacteria 15959
31 Ga0068855_100026010 3300005563 Bacteria 7000
32 Ga0068856_100011270 3300005614 Bacteria 8678
33 Ga0068856_100042368 3300005614 Bacteria 4478
34 Ga0068852_100040258 3300005616 Bacteria 3941
35 Ga0081539_10001169 3300005985 Bacteria 47510
36 Ga0075366_10008152 3300006195 Bacteria 5813
37 Ga0075431_100049655 3300006847 Bacteria 4325
38 Ga0105240_10000078 3300009093 Bacteria 196646
39 Ga0111539_10067610 3300009094 Bacteria 4219
40 Ga0105241_10157077 3300009174 Bacteria 1866
41 Ga0105237_10001165 3300009545 Bacteria 35143
42 Ga0105239_10000431 3300010375 Bacteria 61098
43 Ga0105239_10037742 3300010375 Bacteria 5295
44 Ga0157373_10003825 3300013100 Bacteria 11378
45 Ga0157373_10058573 3300013100 Bacteria 2731
46 Ga0157371_10001708 3300013102 Bacteria 22354
47 Ga0157371_10003164 3300013102 Bacteria 15153
48 Ga0157371_10007282 3300013102 Bacteria 8988
49 Ga0157371_10008068 3300013102 Bacteria 8420
50 Ga0157371_10011431 3300013102 Bacteria 6840
51 Ga0157371_10053225 3300013102 Bacteria 2874
52 Ga0157371_10095938 3300013102 Bacteria 2101
53 Ga0157370_10000956 3300013104 Bacteria 36647
54 Ga0157370_10002557 3300013104 Bacteria 21831
55 Ga0157370_10005134 3300013104 Bacteria 14766
56 Ga0157370_10005293 3300013104 Bacteria 14491
57 Ga0157370_10106146 3300013104 Bacteria 2629
58 Ga0157369_10002663 3300013105 Bacteria 21313
59 Ga0157369_10005343 3300013105 Bacteria 14966
60 Ga0157374_10056493 3300013296 Bacteria 3664
61 Ga0157374_10129833 3300013296 Bacteria 2438
62 Ga0163162_10002976 3300013306 Bacteria 16179
63 Ga0157372_10015677 3300013307 Bacteria 8127
64 Ga0157372_10143569 3300013307 Bacteria 2753
65 Ga0163163_10119015 3300014325 Bacteria 2674
66 Ga0209646_1000002 3300025246 Bacteria 1425781
67 Ga0209026_1000086 3300025250 Bacteria 185551
68 Ga0209673_1000082 3300025273 Bacteria 219716
69 Ga0209564_1003432 3300025295 Bacteria 10861
70 Ga0209758_1002611 3300025297 Bacteria 17961
71 Ga0209050_1000555 3300025298 Bacteria 61428
72 Ga0207426_1000493 3300025302 Bacteria 59050
73 Ga0209257_1000001 3300025304 Bacteria 2274655
74 Ga0209257_1007531 3300025304 Bacteria 6541
75 Ga0207647_10028451 3300025904 Bacteria 3629
76 Ga0207705_10002548 3300025909 Bacteria 14024
77 Ga0207695_10000064 3300025913 Bacteria 346010
78 Ga0207695_10014224 3300025913 Bacteria 9439
79 Ga0207695_10111187 3300025913 Bacteria 2719
80 Ga0207671_10000030 3300025914 Bacteria 248197
81 Ga0207660_10003854 3300025917 Bacteria 9777
82 Ga0207657_10000872 3300025919 Bacteria 31816
83 Ga0207657_10098104 3300025919 Bacteria 2435
84 Ga0207657_10105043 3300025919 Bacteria 2339
85 Ga0207649_10058594 3300025920 Bacteria 2412
86 Ga0207652_10000228 3300025921 Bacteria 58720
87 Ga0207652_10022299 3300025921 Bacteria 5237
88 Ga0207659_10018839 3300025926 Bacteria 4531
89 Ga0207690_10075674 3300025932 Bacteria 2335
90 Ga0207706_10005563 3300025933 Bacteria 11747
91 Ga0207667_10000312 3300025949 Bacteria 67340
92 Ga0207667_10180466 3300025949 Bacteria 2168
93 Ga0207678_10013732 3300026067 Bacteria 7113
94 Ga0207648_10013767 3300026089 Bacteria 7507
95 Ga0207674_10022907 3300026116 Bacteria 6701
96 Ga0207674_10041696 3300026116 Bacteria 4745
97 Ga0207674_10146944 3300026116 Bacteria 2316
98 Ga0268266_10000845 3300028379 Bacteria 39924
99 Ga0265324_10007521 3300029957 Bacteria 4407
100 Ga0265327_10000026 3300031251 Bacteria 379288
101 Ga0265327_10000137 3300031251 Bacteria 160704
102 Ga0265327_10001558 3300031251 Bacteria 28149
103 Ga0395899_0013279 3300037312 Bacteria 6302
104 Ga0395899_0043494 3300037312 Bacteria 3350
105 Ga0395900_0008777 3300037418 Bacteria 10386
106 Ga0395898_0025804 3300037466 Bacteria 5917
107 Ga0395898_0112715 3300037466 Unclassified 2606
108 Ga0395901_0002103 3300038443 Bacteria 20429
109 Ga0395901_0068958 3300038443 Bacteria 3683
110 Ga0439431_0000340 3300041997 Bacteria 9775
111 Ga0453684_0036901 3300044712 Bacteria 6723
112 Ga0466970_0023647 3300044765 Bacteria 3211
113 Ga0466960_0059014 3300044901 Bacteria 1876
114 Ga0495594_0073275 3300046499 Unclassified 1906
115 Ga0495668_0000057 3300046616 Bacteria 196557
116 Ga0495668_0000878 3300046616 Bacteria 33873
117 Ga0495668_0006718 3300046616 Bacteria 7491
118 Ga0495600_0017098 3300046809 Bacteria 4611
119 Ga0495636_0000062 3300047318 Bacteria 47016
120 Ga0495686_0001275 3300047472 Bacteria 28512
121 Ga0496114_0000420 3300048917 Bacteria 31391
122 Ga0496115_0069945 3300048918 Bacteria 2844
123 Ga0496126_0095626 3300048929 Bacteria 2605
124 Ga0501034_0066634 3300049571 Bacteria 3614
125 Ga0501038_0077895 3300049574 Bacteria 2798
126 Ga0501047_0012511 3300049581 Bacteria 8037
127 Ga0501219_000173 3300049703 Bacteria 12003
128 Ga0501035_0110701 3300049822 Bacteria 2407
129 Ga0501044_0179179 3300049823 Bacteria 2087
130 Ga0501284_00032 3300050005 Bacteria 64343
131 nmdc:mga0k408_7338_c1 3300050493 Bacteria 5888
132 nmdc:mga06r32_36948_c1 3300050510 Bacteria 4620
133 nmdc:mga08y16_38709_c1 3300050511 Bacteria 5005
134 Ga0500642_0020219 3300053130 Bacteria 2613
135 Ga0500652_014903 3300053131 Bacteria 2793
136 Ga0500604_0006745 3300053151 Unclassified 3039
137 Ga0500616_0002144 3300053153 Bacteria 17082
138 Ga0500622_0000077 3300053156 Bacteria 108558
139 Ga0500627_0003721 3300053158 Bacteria 4776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100031745 Ga0070675_1000317452 473
2 3300053158 Ga0500627_0003721 Ga0500627_0003721_2099_3751 508
3 3300005459 Ga0068867_100007221 Ga0068867_1000072212 515
4 3300026089 Ga0207648_10013767 Ga0207648_100137678 515
5 3300026116 Ga0207674_10146944 Ga0207674_101469441 529
6 3300003323 rootH1_10102767 rootH1_101027673 530
7 3300049703 Ga0501219_000173 Ga0501219_000173_6785_8413 536
8 3300050005 Ga0501284_00032 Ga0501284_00032_39416_41044 536
9 3300013102 Ga0157371_10007282 Ga0157371_100072825 538
10 3300005329 Ga0070683_100005156 Ga0070683_10000515610 539
11 3300005335 Ga0070666_10022716 Ga0070666_100227162 539
12 3300005338 Ga0068868_100114133 Ga0068868_1001141332 539
13 3300005364 Ga0070673_100065818 Ga0070673_1000658183 539
14 3300005366 Ga0070659_100005889 Ga0070659_1000058892 539
15 3300005458 Ga0070681_10142199 Ga0070681_101421992 539
16 3300005539 Ga0068853_100016658 Ga0068853_1000166582 539
17 3300005563 Ga0068855_100026010 Ga0068855_1000260104 539
18 3300005614 Ga0068856_100011270 Ga0068856_1000112702 539
19 3300005616 Ga0068852_100040258 Ga0068852_1000402585 539
20 3300025919 Ga0207657_10000872 Ga0207657_1000087218 539
21 3300025920 Ga0207649_10058594 Ga0207649_100585941 539
22 3300025932 Ga0207690_10075674 Ga0207690_100756741 539
23 3300025933 Ga0207706_10005563 Ga0207706_100055634 539
24 3300026116 Ga0207674_10022907 Ga0207674_100229076 539
25 3300013306 Ga0163162_10002976 Ga0163162_100029762 540
26 3300025921 Ga0207652_10022299 Ga0207652_100222991 540
27 3300053156 Ga0500622_0000077 Ga0500622_0000077_43462_45135 540
28 3300005455 Ga0070663_100095681 Ga0070663_1000956811 542
29 3300005458 Ga0070681_10009168 Ga0070681_100091687 542
30 3300005563 Ga0068855_100000399 Ga0068855_1000003992 542
31 3300005614 Ga0068856_100042368 Ga0068856_1000423682 542
32 3300013102 Ga0157371_10003164 Ga0157371_1000316410 542
33 3300025909 Ga0207705_10002548 Ga0207705_100025486 542
34 3300025917 Ga0207660_10003854 Ga0207660_100038544 542
35 3300025919 Ga0207657_10105043 Ga0207657_101050433 542
36 3300025921 Ga0207652_10000228 Ga0207652_1000022826 542
37 3300025949 Ga0207667_10000312 Ga0207667_1000031217 542
38 3300026067 Ga0207678_10013732 Ga0207678_100137322 542
39 3300037312 Ga0395899_0013279 Ga0395899_0013279_2189_3856 542
40 3300037418 Ga0395900_0008777 Ga0395900_0008777_7693_9360 542
41 3300037466 Ga0395898_0025804 Ga0395898_0025804_1039_2706 542
42 3300038443 Ga0395901_0068958 Ga0395901_0068958_1003_2670 542
43 3300048929 Ga0496126_0095626 Ga0496126_0095626_245_1918 544
44 iso_pu_bacteria 2600254943 2600400837 544
45 3300013104 Ga0157370_10106146 Ga0157370_101061462 546
46 iso_pu_bacteria 2599185353 2600198059 548
47 3300053153 Ga0500616_0002144 Ga0500616_0002144_6986_8785 549
48 3300046616 Ga0495668_0000057 Ga0495668_0000057_101186_102838 550
49 3300053130 Ga0500642_0020219 Ga0500642_0020219_76_1728 550
50 iso_pu_bacteria 2881955468 2881956127 550
51 3300009094 Ga0111539_10067610 Ga0111539_100676102 551
52 3300025926 Ga0207659_10018839 Ga0207659_100188392 551
53 3300050511 nmdc:mga08y16_38709_c1 nmdc:mga08y16_38709_c1_73_1731 551
54 3300031251 Ga0265327_10000026 Ga0265327_10000026252 552
55 3300044901 Ga0466960_0059014 Ga0466960_0059014_69_1751 552
56 3300046616 Ga0495668_0000878 Ga0495668_0000878_7698_9368 552
57 iso_pu_bacteria 2840677318 2840677515 552
58 iso_pu_bacteria 2883068021 2883072900 552
59 iso_pu_bacteria 2896085136 2896085333 552
60 iso_pu_bacteria 2929921140 2929923487 552
61 iso_pu_bacteria 8003151029 8003152889 552
62 3300003322 rootL2_10088285 rootL2_100882856 553
63 3300005530 Ga0070679_100054498 Ga0070679_1000544982 553
64 3300010375 Ga0105239_10037742 Ga0105239_100377424 553
65 3300013102 Ga0157371_10011431 Ga0157371_100114315 553
66 3300013102 Ga0157371_10053225 Ga0157371_100532251 553
67 3300013104 Ga0157370_10005293 Ga0157370_1000529315 553
68 3300013105 Ga0157369_10005343 Ga0157369_100053439 553
69 3300013307 Ga0157372_10143569 Ga0157372_101435692 553
70 3300025904 Ga0207647_10028451 Ga0207647_100284511 553
71 3300025949 Ga0207667_10180466 Ga0207667_101804662 553
72 3300026116 Ga0207674_10041696 Ga0207674_100416962 553
73 3300031251 Ga0265327_10001558 Ga0265327_1000155811 553
74 3300046616 Ga0495668_0006718 Ga0495668_0006718_702_2384 553
75 3300049571 Ga0501034_0066634 Ga0501034_0066634_340_2007 553
76 3300049574 Ga0501038_0077895 Ga0501038_0077895_469_2130 553
77 3300049581 Ga0501047_0012511 Ga0501047_0012511_197_1879 553
78 3300049822 Ga0501035_0110701 Ga0501035_0110701_469_2130 553
79 3300049823 Ga0501044_0179179 Ga0501044_0179179_167_1849 553
80 3300053151 Ga0500604_0006745 Ga0500604_0006745_623_2305 553
81 3300003794 Ga0055531_10000085 Ga0055531_1000008556 554
82 3300013100 Ga0157373_10003825 Ga0157373_100038254 554
83 3300013102 Ga0157371_10008068 Ga0157371_100080685 554
84 3300013104 Ga0157370_10000956 Ga0157370_1000095621 554
85 3300025304 Ga0209257_1000001 Ga0209257_10000011221 554
86 3300037466 Ga0395898_0112715 Ga0395898_0112715_702_2372 554
87 3300001989 JGI24739J22299_10018751 JGI24739J22299_100187512 555
88 3300003323 rootH1_10090389 rootH1_100903892 555
89 3300003771 Ga0055526_1016377 Ga0055526_10163772 555
90 3300003790 Ga0055528_1007321 Ga0055528_10073214 555
91 3300003791 Ga0055530_10003713 Ga0055530_100037134 555
92 3300005262 Ga0065165_1000010 Ga0065165_1000010110 555
93 3300005563 Ga0068855_100005141 Ga0068855_10000514110 555
94 3300005985 Ga0081539_10001169 Ga0081539_1000116933 555
95 3300006195 Ga0075366_10008152 Ga0075366_100081523 555
96 3300006847 Ga0075431_100049655 Ga0075431_1000496555 555
97 3300013100 Ga0157373_10058573 Ga0157373_100585732 555
98 3300013102 Ga0157371_10001708 Ga0157371_1000170810 555
99 3300013102 Ga0157371_10095938 Ga0157371_100959382 555
100 3300013104 Ga0157370_10005134 Ga0157370_100051345 555
101 3300013105 Ga0157369_10002663 Ga0157369_1000266318 555
102 3300013296 Ga0157374_10056493 Ga0157374_100564933 555
103 3300013296 Ga0157374_10129833 Ga0157374_101298333 555
104 3300014325 Ga0163163_10119015 Ga0163163_101190152 555
105 3300025273 Ga0209673_1000082 Ga0209673_100008284 555
106 3300025295 Ga0209564_1003432 Ga0209564_10034325 555
107 3300025298 Ga0209050_1000555 Ga0209050_100055549 555
108 3300025304 Ga0209257_1007531 Ga0209257_10075312 555
109 3300025913 Ga0207695_10111187 Ga0207695_101111873 555
110 3300025919 Ga0207657_10098104 Ga0207657_100981042 555
111 3300037312 Ga0395899_0043494 Ga0395899_0043494_108_1787 555
112 3300038443 Ga0395901_0002103 Ga0395901_0002103_15568_17247 555
113 3300044765 Ga0466970_0023647 Ga0466970_0023647_1428_3116 555
114 3300047472 Ga0495686_0001275 Ga0495686_0001275_9929_11596 555
115 3300050493 nmdc:mga0k408_7338_c1 nmdc:mga0k408_7338_c1_172_1857 555
116 3300050510 nmdc:mga06r32_36948_c1 nmdc:mga06r32_36948_c1_1515_3188 555
117 3300001979 JGI24740J21852_10002103 JGI24740J21852_100021034 556
118 3300002738 JGI25154J39366_1000007 JGI25154J39366_1000007157 556
119 3300003215 JGI25153J46596_10002940 JGI25153J46596_100029402 556
120 3300003354 JGI25160J50197_1013928 JGI25160J50197_10139282 556
121 3300005548 Ga0070665_100000442 Ga0070665_10000044251 556
122 3300009093 Ga0105240_10000078 Ga0105240_10000078124 556
123 3300009174 Ga0105241_10157077 Ga0105241_101570771 556
124 3300009545 Ga0105237_10001165 Ga0105237_100011653 556
125 3300010375 Ga0105239_10000431 Ga0105239_1000043146 556
126 3300013104 Ga0157370_10002557 Ga0157370_1000255712 556
127 3300013307 Ga0157372_10015677 Ga0157372_100156775 556
128 3300025246 Ga0209646_1000002 Ga0209646_1000002762 556
129 3300025250 Ga0209026_1000086 Ga0209026_100008626 556
130 3300025297 Ga0209758_1002611 Ga0209758_10026117 556
131 3300025302 Ga0207426_1000493 Ga0207426_10004932 556
132 3300025913 Ga0207695_10000064 Ga0207695_1000006479 556
133 3300025913 Ga0207695_10014224 Ga0207695_100142242 556
134 3300025914 Ga0207671_10000030 Ga0207671_1000003034 556
135 3300028379 Ga0268266_10000845 Ga0268266_1000084529 556
136 3300029957 Ga0265324_10007521 Ga0265324_100075211 556
137 3300031251 Ga0265327_10000137 Ga0265327_1000013715 556
138 3300041997 Ga0439431_0000340 Ga0439431_0000340_7356_9038 556
139 3300044712 Ga0453684_0036901 Ga0453684_0036901_1780_3462 556
140 3300047318 Ga0495636_0000062 Ga0495636_0000062_23033_24715 556
141 3300048917 Ga0496114_0000420 Ga0496114_0000420_20988_22664 556
142 3300053131 Ga0500652_014903 Ga0500652_014903_633_2324 556
143 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00007860 557
144 3300005289 Ga0065704_10070140 Ga0065704_10070140148 557
145 3300046499 Ga0495594_0073275 Ga0495594_0073275_83_1822 557
146 3300046809 Ga0495600_0017098 Ga0495600_0017098_1231_2970 557
147 3300048918 Ga0496115_0069945 Ga0496115_0069945_907_2646 557

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14716

HHH_8

Helix-hairpin-helix domain

53

121

0.97

PF14520

HHH_5

Helix-hairpin-helix domain

139

196

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m65-assembly1.cif.gz_A ycdx protein 0.8815 318 553
3au6-assembly1.cif.gz_A dna polymerase x from thermus thermophilus hb8 ternary complex with primer/template dna and ddgtp 0.8661 1 551
3au6-assembly1.cif.gz_A dna polymerase x from thermus thermophilus hb8 ternary complex with primer/template dna and ddgtp 0.8561 1 551
1m65-assembly1.cif.gz_A ycdx protein 0.8354 318 553
1pb0-assembly1.cif.gz_A ycdx protein in autoinhibited state 0.8303 317 553
ID Description Score Start End Superfamily
2w9mA05 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9699 310 555 3.20.20.140
af_Q2FZD4_322_570_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9674 311 557 3.20.20.140
2w9mB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9547 86 152 1.10.150.20
3au6A05 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9507 308 551 3.20.20.140
af_Q2FZD4_322_570_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9484 311 557 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A259HI57-F1-model_v4 Histidinol-phosphatase 0.9899 322 556 GO:0005829
GO:0008270
GO:0042578
AF-A0A3D3CWE4-F1-model_v4 Histidinol-phosphatase 0.9893 275 551 GO:0005829
GO:0008270
GO:0042578
GO:0071978
AF-A0A4Q3ST74-F1-model_v4 PHP domain-containing protein 0.9849 373 556 GO:0005829
GO:0008270
GO:0042578
GO:0071978
AF-A0A7C3XT46-F1-model_v4 PHP domain-containing protein 0.9802 350 554 GO:0005829
GO:0008270
GO:0042578
GO:0071978
AF-A0A4Q3ND94-F1-model_v4 deleted 0.9794 451 556

Feature Viewer

pLDDT pTM Quality
91.88 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map