F201207

General Info

Members Datasets Scaffolds Average Seq Length
147 107 294 152

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0175665|Ga0466967_0175665_140_655
Length 171
Sequence VSPRAGVTPGEIGGRKEPVIDADDNHIPVSYENCDQIAGPFYHGTKSKLEVGDDLVVGYNSNYQAGRVSNNIYFTALVETAAWGAELATALAGSEERGHIYVVEPLGPFEDDPNVTDKRFPGNPTQSYRTRHPLRVVGEVDDWTGHDAEALKGMLDHLAQLREQGLDLIED

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
16 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
60 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
73 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
76 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
77 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
78 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
83 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
104 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
105 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
106 2643221641 Nocardioides sp. Root122 Isolate Unclassified
107 2739367898 Nocardioides sp. CF479 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.6
Metatranscriptomes 2.04
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.84
Nodule 0
Rhizoplane 10.2
Rhizosphere 76.87
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0175665 3300045976 Bacteria 2018
2 Ga0070658_10041619 3300005327 Bacteria 3707
3 Ga0070683_100651633 3300005329 Bacteria 1008
4 Ga0070683_101382453 3300005329 Bacteria 677
5 Ga0070680_100012037 3300005336 Bacteria 6712
6 Ga0070680_100163456 3300005336 Bacteria 1871
7 Ga0068868_100830129 3300005338 Bacteria 836
8 Ga0070660_100033132 3300005339 Bacteria 3892
9 Ga0070661_101006427 3300005344 Unclassified 691
10 Ga0070663_100836982 3300005455 Bacteria 791
11 Ga0070681_10000252 3300005458 Bacteria 42364
12 Ga0070681_10012622 3300005458 Bacteria 8381
13 Ga0070681_10039553 3300005458 Bacteria 4727
14 Ga0070679_100000070 3300005530 Bacteria 76125
15 Ga0070679_100010984 3300005530 Bacteria 8605
16 Ga0070679_100121528 3300005530 Bacteria 2596
17 Ga0070684_100011531 3300005535 Bacteria 7040
18 Ga0068852_101569229 3300005616 Bacteria 681
19 Ga0075365_10025684 3300006038 Bacteria 3731
20 Ga0075365_10272081 3300006038 Bacteria 1191
21 Ga0075365_10506846 3300006038 Bacteria 853
22 Ga0075364_10041816 3300006051 Bacteria 2977
23 Ga0075364_10124134 3300006051 Bacteria 1730
24 Ga0105241_10968908 3300009174 Bacteria 794
25 Ga0105242_10256738 3300009176 Bacteria 1577
26 Ga0105242_11143418 3300009176 Bacteria 795
27 Ga0105248_10133855 3300009177 Bacteria 2797
28 Ga0105239_10486987 3300010375 Bacteria 1401
29 Ga0157371_10359778 3300013102 Bacteria 1060
30 Ga0157369_10081221 3300013105 Bacteria 3470
31 Ga0157378_11882740 3300013297 Bacteria 647
32 Ga0157372_10869402 3300013307 Unclassified 1046
33 Ga0157375_10026762 3300013308 Bacteria 5382
34 Ga0157375_10679003 3300013308 Bacteria 1185
35 Ga0163163_10065052 3300014325 Bacteria 3618
36 Ga0163163_12537010 3300014325 Bacteria 570
37 Ga0157380_11903272 3300014326 Bacteria 655
38 Ga0157377_10798315 3300014745 Bacteria 696
39 Ga0163161_10353327 3300017792 Bacteria 1169
40 Ga0206351_10952333 3300020077 Bacteria 611
41 Ga0206354_10887490 3300020081 Bacteria 860
42 Ga0206353_10409278 3300020082 Bacteria 6126
43 Ga0207643_10328831 3300025908 Bacteria 956
44 Ga0207705_10181333 3300025909 Bacteria 1589
45 Ga0207654_10708897 3300025911 Bacteria 723
46 Ga0207707_10000153 3300025912 Bacteria 72436
47 Ga0207707_10026459 3300025912 Bacteria 5070
48 Ga0207707_10030384 3300025912 Bacteria 4727
49 Ga0207660_10021766 3300025917 Bacteria 4315
50 Ga0207660_10024760 3300025917 Bacteria 4065
51 Ga0207660_10149128 3300025917 Bacteria 1795
52 Ga0207657_10023868 3300025919 Bacteria 5682
53 Ga0207652_10000221 3300025921 Bacteria 60227
54 Ga0207652_10003757 3300025921 Bacteria 12440
55 Ga0207652_10148252 3300025921 Bacteria 2100
56 Ga0207686_10300200 3300025934 Bacteria 1192
57 Ga0207686_10407538 3300025934 Bacteria 1037
58 Ga0207661_10633237 3300025944 Bacteria 983
59 Ga0207679_12114810 3300025945 Bacteria 511
60 Ga0207640_10613310 3300025981 Bacteria 923
61 Ga0207708_10359265 3300026075 Bacteria 1197
62 Ga0207683_11169829 3300026121 Bacteria 713
63 Ga0207698_10191107 3300026142 Bacteria 1824
64 Ga0265322_10058327 3300028654 Bacteria 1095
65 Ga0307408_100552160 3300031548 Bacteria 1017
66 Ga0307405_11002538 3300031731 Bacteria 712
67 Ga0307406_10243350 3300031901 Bacteria 1351
68 Ga0307406_10620566 3300031901 Bacteria 894
69 Ga0307407_10166410 3300031903 Bacteria 1448
70 Ga0307407_11091843 3300031903 Bacteria 620
71 Ga0307412_10296126 3300031911 Bacteria 1277
72 Ga0307409_101140736 3300031995 Bacteria 802
73 Ga0307409_101771735 3300031995 Bacteria 647
74 Ga0307416_100396731 3300032002 Bacteria 1416
75 Ga0307416_100702112 3300032002 Bacteria 1101
76 Ga0307415_101037901 3300032126 Bacteria 764
77 Ga0316574_0031321 3300035398 Bacteria 3226
78 Ga0395899_0022257 3300037312 Bacteria 4808
79 Ga0395899_0042580 3300037312 Bacteria 3389
80 Ga0395900_0386069 3300037418 Bacteria 1367
81 Ga0395898_1964538 3300037466 Bacteria 504
82 Ga0395905_1333516 3300037471 Bacteria 621
83 Ga0451797_0428035 3300041453 Bacteria 711
84 Ga0451841_0201769 3300041498 Bacteria 551
85 Ga0451853_3527123 3300041512 Bacteria 651
86 Ga0451577_0136323 3300042876 Bacteria 2204
87 Ga0453683_0000037 3300044673 Bacteria 230268
88 Ga0466961_0130990 3300044693 Bacteria 1572
89 Ga0466963_0109866 3300044694 Bacteria 1892
90 Ga0453684_0014618 3300044712 Bacteria 12530
91 Ga0466970_0425428 3300044765 Bacteria 759
92 Ga0466957_0104039 3300044842 Bacteria 1793
93 Ga0466960_0067662 3300044901 Bacteria 1770
94 Ga0466960_0150850 3300044901 Bacteria 1242
95 Ga0466960_0274949 3300044901 Bacteria 942
96 Ga0466960_0280998 3300044901 Bacteria 933
97 Ga0466960_0606544 3300044901 Bacteria 650
98 Ga0466960_0699798 3300044901 Bacteria 608
99 Ga0466959_0672917 3300045049 Bacteria 694
100 Ga0466958_0031510 3300045836 Bacteria 3152
101 Ga0466958_0119097 3300045836 Bacteria 1652
102 Ga0466958_0362174 3300045836 Bacteria 934
103 Ga0466967_0021662 3300045976 Bacteria 5227
104 Ga0466967_0155975 3300045976 Bacteria 2138
105 Ga0495605_0000015 3300046474 Bacteria 300227
106 Ga0495596_0189198 3300046500 Bacteria 800
107 Ga0495607_0006902 3300046501 Bacteria 7915
108 Ga0495606_0000290 3300046507 Bacteria 87022
109 Ga0495610_0046491 3300046512 Bacteria 2140
110 Ga0495597_0001369 3300046542 Bacteria 17627
111 Ga0495633_0001177 3300046558 Bacteria 21028
112 Ga0495633_0008772 3300046558 Bacteria 5656
113 Ga0495656_0491044 3300046615 Bacteria 650
114 Ga0495668_0000177 3300046616 Bacteria 94811
115 Ga0495658_0508331 3300046683 Bacteria 771
116 Ga0495660_0044634 3300046810 Bacteria 2437
117 Ga0495683_0074968 3300047323 Bacteria 1657
118 Ga0495686_0002547 3300047472 Bacteria 17027
119 Ga0496100_1556684 3300048903 Bacteria 522
120 Ga0496102_0298592 3300048905 Bacteria 1518
121 Ga0496103_0064000 3300048906 Bacteria 2292
122 Ga0496103_0475546 3300048906 Bacteria 800
123 Ga0496104_0057915 3300048907 Bacteria 3667
124 Ga0496104_0420347 3300048907 Bacteria 1249
125 Ga0496105_0214536 3300048908 Bacteria 1568
126 Ga0496106_0005198 3300048909 Bacteria 9638
127 Ga0496108_0157891 3300048911 Bacteria 1959
128 Ga0496110_0060920 3300048913 Bacteria 3329
129 Ga0496110_0491270 3300048913 Bacteria 1118
130 Ga0496111_0079984 3300048914 Bacteria 2384
131 Ga0496112_0786511 3300048915 Bacteria 877
132 Ga0496113_0049025 3300048916 Bacteria 3144
133 Ga0496121_0055085 3300048924 Bacteria 3316
134 Ga0496126_0000123 3300048929 Bacteria 182726
135 Ga0501073_0045101 3300049589 Bacteria 3106
136 Ga0501074_0254995 3300049590 Bacteria 1247
137 nmdc:mga03683_30507_c1 3300050489 Bacteria 2157
138 nmdc:mga00v17_133629_c1 3300050491 Bacteria 1587
139 nmdc:mga00v17_24959_c1 3300050491 Bacteria 3469
140 nmdc:mga0yw44_205840_c1 3300050492 Bacteria 1301
141 nmdc:mga0yw44_327133_c1 3300050492 Bacteria 1030
142 nmdc:mga0yw44_641899_c1 3300050492 Bacteria 721
143 Ga0500593_000886 3300053117 Bacteria 11119
144 Ga0500573_0099459 3300053140 Bacteria 1638
145 Ga0466962_0363771 3300061719 Bacteria 721
146 2644230143 2643221641 Bacteria 4490190
147 2740169192 2739367898 Bacteria 4367674
148 Ga0466967_0175665
149 Ga0070658_10041619
150 Ga0070683_100651633
151 Ga0070683_101382453
152 Ga0070680_100012037
153 Ga0070680_100163456
154 Ga0068868_100830129
155 Ga0070660_100033132
156 Ga0070661_101006427
157 Ga0070663_100836982
158 Ga0070681_10000252
159 Ga0070681_10012622
160 Ga0070681_10039553
161 Ga0070679_100000070
162 Ga0070679_100010984
163 Ga0070679_100121528
164 Ga0070684_100011531
165 Ga0068852_101569229
166 Ga0075365_10025684
167 Ga0075365_10272081
168 Ga0075365_10506846
169 Ga0075364_10041816
170 Ga0075364_10124134
171 Ga0105241_10968908
172 Ga0105242_10256738
173 Ga0105242_11143418
174 Ga0105248_10133855
175 Ga0105239_10486987
176 Ga0157371_10359778
177 Ga0157369_10081221
178 Ga0157378_11882740
179 Ga0157372_10869402
180 Ga0157375_10026762
181 Ga0157375_10679003
182 Ga0163163_10065052
183 Ga0163163_12537010
184 Ga0157380_11903272
185 Ga0157377_10798315
186 Ga0163161_10353327
187 Ga0206351_10952333
188 Ga0206354_10887490
189 Ga0206353_10409278
190 Ga0207643_10328831
191 Ga0207705_10181333
192 Ga0207654_10708897
193 Ga0207707_10000153
194 Ga0207707_10026459
195 Ga0207707_10030384
196 Ga0207660_10021766
197 Ga0207660_10024760
198 Ga0207660_10149128
199 Ga0207657_10023868
200 Ga0207652_10000221
201 Ga0207652_10003757
202 Ga0207652_10148252
203 Ga0207686_10300200
204 Ga0207686_10407538
205 Ga0207661_10633237
206 Ga0207679_12114810
207 Ga0207640_10613310
208 Ga0207708_10359265
209 Ga0207683_11169829
210 Ga0207698_10191107
211 Ga0265322_10058327
212 Ga0307408_100552160
213 Ga0307405_11002538
214 Ga0307406_10243350
215 Ga0307406_10620566
216 Ga0307407_10166410
217 Ga0307407_11091843
218 Ga0307412_10296126
219 Ga0307409_101140736
220 Ga0307409_101771735
221 Ga0307416_100396731
222 Ga0307416_100702112
223 Ga0307415_101037901
224 Ga0316574_0031321
225 Ga0395899_0022257
226 Ga0395899_0042580
227 Ga0395900_0386069
228 Ga0395898_1964538
229 Ga0395905_1333516
230 Ga0451797_0428035
231 Ga0451841_0201769
232 Ga0451853_3527123
233 Ga0451577_0136323
234 Ga0453683_0000037
235 Ga0466961_0130990
236 Ga0466963_0109866
237 Ga0453684_0014618
238 Ga0466970_0425428
239 Ga0466957_0104039
240 Ga0466960_0067662
241 Ga0466960_0150850
242 Ga0466960_0274949
243 Ga0466960_0280998
244 Ga0466960_0606544
245 Ga0466960_0699798
246 Ga0466959_0672917
247 Ga0466958_0031510
248 Ga0466958_0119097
249 Ga0466958_0362174
250 Ga0466967_0021662
251 Ga0466967_0155975
252 Ga0495605_0000015
253 Ga0495596_0189198
254 Ga0495607_0006902
255 Ga0495606_0000290
256 Ga0495610_0046491
257 Ga0495597_0001369
258 Ga0495633_0001177
259 Ga0495633_0008772
260 Ga0495656_0491044
261 Ga0495668_0000177
262 Ga0495658_0508331
263 Ga0495660_0044634
264 Ga0495683_0074968
265 Ga0495686_0002547
266 Ga0496100_1556684
267 Ga0496102_0298592
268 Ga0496103_0064000
269 Ga0496103_0475546
270 Ga0496104_0057915
271 Ga0496104_0420347
272 Ga0496105_0214536
273 Ga0496106_0005198
274 Ga0496108_0157891
275 Ga0496110_0060920
276 Ga0496110_0491270
277 Ga0496111_0079984
278 Ga0496112_0786511
279 Ga0496113_0049025
280 Ga0496121_0055085
281 Ga0496126_0000123
282 Ga0501073_0045101
283 Ga0501074_0254995
284 nmdc:mga03683_30507_c1
285 nmdc:mga00v17_133629_c1
286 nmdc:mga00v17_24959_c1
287 nmdc:mga0yw44_205840_c1
288 nmdc:mga0yw44_327133_c1
289 nmdc:mga0yw44_641899_c1
290 Ga0500593_000886
291 Ga0500573_0099459
292 Ga0466962_0363771
293 2644230143
294 2740169192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12120

Arr-ms

Rifampin ADP-ribosyl transferase

41

143

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hw2-assembly1.cif.gz_A crystal structure of rifampin adp-ribosyl transferase in complex with rifampin 0.9639 21 153
2hw2-assembly1.cif.gz_A crystal structure of rifampin adp-ribosyl transferase in complex with rifampin 0.8961 21 153
1tii-assembly1.cif.gz_A escherichia coli heat labile enterotoxin type iib 0.5752 51 117
1s5e-assembly2.cif.gz_B cholera holotoxin, crystal form 1 0.5677 23 113
4qa7-assembly1.cif.gz_A crystal structure of h334r/y306f hdac8 in complex with a tetrapeptide substrate 0.5661 116 140
ID Description Score Start End Superfamily
2hw2A00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Rifampin ADP-ribosyltransferase domain 0.9639 21 153 3.20.170.40
2hw2A00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Rifampin ADP-ribosyltransferase domain 0.8961 21 153 3.20.170.40
3k4uD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6245 112 149 3.40.190.10
2auaA01 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;ADP-ribosylation domain 0.6012 23 125 3.20.170.10
2auaA01 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;ADP-ribosylation domain 0.5374 23 125 3.20.170.10
ID Description Score Start End GO Terms
AF-A0A350CL49-F1-model_v4 NAD(+)--rifampin ADP-ribosyltransferase 0.9924 9 153 GO:0016740
AF-A0A117LI87-F1-model_v4 deleted 0.9917 9 153
AF-A0A839JHY7-F1-model_v4 NAD(+)--rifampin ADP-ribosyltransferase 0.9916 19 153 GO:0016740
AF-A0A1G6ISJ6-F1-model_v4 Rifampin ADP-ribosylating transferase 0.9861 52 153 GO:0016740
AF-U5N3Y0-F1-model_v4 Rifampin ADP-ribosylating transferase ARR 0.9853 9 153 GO:0016740

Map