F201037

General Info

Members Datasets Scaffolds Average Seq Length
147 88 294 189

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0084709|Ga0436361_0084709_82_762
Length 226
Sequence MSGENIGPPGPPVGQDAPRPGGSGPLGASGRPPPYKQGSVVRYKAALRKAIRRNAREPEIDFLNITAMLDLMTIILVFLLKSMSASSASIPQSKDLTLPSSIITTEAAQEGTVIVISKTQILVGDDPNPVVLLPGPEQLAQSGVDTKYKRSGPNDMYIVPLANALSNARDTDKKIRAAKGQDTSTSEAVIVADATTPYRLLIEVLFTAGQSEFGKYHLMVRSGRKK

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
12 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
20 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
21 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
38 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
40 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
41 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
42 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
43 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
44 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
47 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
58 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
66 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
67 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
76 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
83 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
84 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.92
Metatranscriptomes 4.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.04
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0084709 3300039447 Bacteria 911
2 Ga0070658_10387825 3300005327 Bacteria 1199
3 Ga0070683_100018093 3300005329 Bacteria 6236
4 Ga0068868_100040192 3300005338 Bacteria 3639
5 Ga0070674_100947974 3300005356 Bacteria 752
6 Ga0070705_100512407 3300005440 Bacteria 913
7 Ga0070708_101238541 3300005445 Bacteria 698
8 Ga0070678_100091326 3300005456 Bacteria 2336
9 Ga0070678_100319097 3300005456 Bacteria 1326
10 Ga0070707_100134733 3300005468 Bacteria 2403
11 Ga0070707_100537670 3300005468 Bacteria 1131
12 Ga0070704_100453177 3300005549 Unclassified 1105
13 Ga0070702_100358801 3300005615 Unclassified 1029
14 Ga0068871_100153910 3300006358 Bacteria 1962
15 Ga0075430_100020511 3300006846 Bacteria 5622
16 Ga0075435_100122284 3300007076 Bacteria 2173
17 Ga0111539_10019553 3300009094 Bacteria 8356
18 Ga0105247_10001165 3300009101 Bacteria 19515
19 Ga0114129_11004095 3300009147 Bacteria 1051
20 Ga0105242_10023675 3300009176 Bacteria 4841
21 Ga0157379_11009330 3300014968 Bacteria 794
22 Ga0157376_10315917 3300014969 Bacteria 1484
23 Ga0207642_10175410 3300025899 Bacteria 1163
24 Ga0207710_10000945 3300025900 Bacteria 15368
25 Ga0207646_10245807 3300025922 Bacteria 1616
26 Ga0207650_10749485 3300025925 Bacteria 826
27 Ga0207686_10030272 3300025934 Bacteria 3202
28 Ga0207670_10007420 3300025936 Bacteria 6117
29 Ga0207704_10175570 3300025938 Bacteria 1542
30 Ga0207661_10831281 3300025944 Bacteria 850
31 Ga0207667_10303917 3300025949 Bacteria 1630
32 Ga0207677_10026443 3300026023 Bacteria 3639
33 Ga0207639_10538703 3300026041 Bacteria 1071
34 Ga0207702_10100246 3300026078 Bacteria 2555
35 Ga0207641_10124607 3300026088 Bacteria 2305
36 Ga0207648_10014832 3300026089 Bacteria 7187
37 Ga0207676_10638772 3300026095 Bacteria 1026
38 Ga0207683_10007579 3300026121 Bacteria 9298
39 Ga0207683_10342144 3300026121 Bacteria 1372
40 Ga0207428_10073823 3300027907 Bacteria 2675
41 Ga0268264_10705134 3300028381 Bacteria 1003
42 Ga0265337_1024692 3300028556 Bacteria 1835
43 Ga0265326_10018756 3300028558 Bacteria 1989
44 Ga0265334_10100284 3300028573 Bacteria 1048
45 Ga0265323_10003056 3300028653 Bacteria 7457
46 Ga0265323_10006365 3300028653 Bacteria 4965
47 Ga0265323_10017581 3300028653 Bacteria 2775
48 Ga0265322_10006715 3300028654 Bacteria 3380
49 Ga0265322_10012513 3300028654 Bacteria 2455
50 Ga0307515_10132824 3300028794 Bacteria 2728
51 Ga0265338_10123938 3300028800 Bacteria 2054
52 Ga0265338_10246245 3300028800 Bacteria 1321
53 Ga0265338_10255216 3300028800 Bacteria 1291
54 Ga0265324_10001219 3300029957 Bacteria 15247
55 Ga0265330_10001249 3300031235 Bacteria 14889
56 Ga0265330_10030805 3300031235 Bacteria 2406
57 Ga0265330_10034500 3300031235 Bacteria 2260
58 Ga0265330_10132452 3300031235 Bacteria 1061
59 Ga0265332_10035572 3300031238 Bacteria 2162
60 Ga0265328_10021159 3300031239 Bacteria 2486
61 Ga0265325_10008542 3300031241 Bacteria 6038
62 Ga0265325_10023096 3300031241 Bacteria 3401
63 Ga0265329_10000177 3300031242 Bacteria 32295
64 Ga0265329_10000843 3300031242 Bacteria 15506
65 Ga0265329_10042969 3300031242 Bacteria 1446
66 Ga0265340_10270968 3300031247 Bacteria 755
67 Ga0265339_10000006 3300031249 Bacteria 259593
68 Ga0265339_10164999 3300031249 Bacteria 1112
69 Ga0265339_10198000 3300031249 Bacteria 992
70 Ga0265331_10029371 3300031250 Bacteria 2744
71 Ga0265316_10000020 3300031344 Bacteria 189456
72 Ga0265316_10000043 3300031344 Bacteria 133134
73 Ga0265316_10000138 3300031344 Bacteria 79599
74 Ga0265316_10009636 3300031344 Bacteria 8873
75 Ga0265316_10015542 3300031344 Bacteria 6650
76 Ga0265316_10022415 3300031344 Bacteria 5324
77 Ga0265316_10033888 3300031344 Bacteria 4153
78 Ga0265316_10037505 3300031344 Bacteria 3910
79 Ga0265316_10059494 3300031344 Unclassified 2971
80 Ga0265316_10133722 3300031344 Bacteria 1866
81 Ga0265313_10013771 3300031595 Bacteria 4822
82 Ga0265314_10000009 3300031711 Bacteria 476805
83 Ga0265314_10004821 3300031711 Bacteria 12339
84 Ga0265314_10013160 3300031711 Bacteria 6701
85 Ga0265342_10000061 3300031712 Bacteria 115218
86 Ga0265342_10001291 3300031712 Bacteria 23558
87 Ga0265342_10003357 3300031712 Bacteria 13225
88 Ga0265342_10036611 3300031712 Bacteria 2997
89 Ga0307406_10000716 3300031901 Bacteria 18704
90 Ga0373962_0052930 3300035242 Bacteria 1174
91 Ga0373935_0225915 3300035692 Bacteria 1302
92 Ga0373927_0018616 3300035695 Bacteria 4561
93 Ga0373925_0051655 3300037068 Bacteria 3069
94 Ga0373925_0054972 3300037068 Bacteria 2979
95 Ga0395905_0128222 3300037471 Bacteria 2386
96 Ga0439465_0014701 3300041413 Bacteria 2440
97 Ga0439431_0017409 3300041997 Bacteria 1689
98 Ga0439445_0002006 3300042004 Bacteria 4493
99 Ga0451577_0000029 3300042876 Bacteria 395301
100 Ga0451577_0036777 3300042876 Bacteria 4408
101 Ga0451577_0155660 3300042876 Bacteria 2057
102 Ga0451577_0542843 3300042876 Bacteria 1055
103 Ga0451577_0652512 3300042876 Bacteria 954
104 Ga0451577_0718450 3300042876 Bacteria 904
105 Ga0453683_0000253 3300044673 Bacteria 70186
106 Ga0453683_0001617 3300044673 Bacteria 18997
107 Ga0453683_0011409 3300044673 Bacteria 5854
108 Ga0453683_0014298 3300044673 Bacteria 5157
109 Ga0453684_0000088 3300044712 Bacteria 395200
110 Ga0453684_0000099 3300044712 Bacteria 375208
111 Ga0453684_0007369 3300044712 Bacteria 20286
112 Ga0453684_0020250 3300044712 Bacteria 10054
113 Ga0453684_0036721 3300044712 Bacteria 6746
114 Ga0453684_0056746 3300044712 Bacteria 5077
115 Ga0453684_0073306 3300044712 Bacteria 4317
116 Ga0453684_0074454 3300044712 Bacteria 4275
117 Ga0453684_0106498 3300044712 Bacteria 3416
118 Ga0453684_0180242 3300044712 Bacteria 2481
119 Ga0453684_0221990 3300044712 Bacteria 2188
120 Ga0453684_0457571 3300044712 Bacteria 1419
121 Ga0453684_0938387 3300044712 Bacteria 924
122 Ga0453684_2240385 3300044712 Bacteria 545
123 Ga0451576_0011719 3300045051 Bacteria 9933
124 Ga0451576_0138312 3300045051 Bacteria 2540
125 Ga0451576_0165382 3300045051 Bacteria 2308
126 Ga0451576_0168734 3300045051 Bacteria 2284
127 Ga0451576_0410411 3300045051 Bacteria 1420
128 Ga0451576_1043073 3300045051 Bacteria 856
129 Ga0495668_0121219 3300046616 Bacteria 1431
130 Ga0496104_0201931 3300048907 Bacteria 1900
131 Ga0496110_0208099 3300048913 Bacteria 1778
132 Ga0496111_0737762 3300048914 Bacteria 715
133 Ga0496126_0583068 3300048929 Bacteria 883
134 Ga0501034_0029447 3300049571 Bacteria 5581
135 Ga0501036_0093006 3300049572 Bacteria 2548
136 Ga0501041_0116803 3300049577 Bacteria 1657
137 Ga0501075_0806249 3300049591 Bacteria 714
138 Ga0501035_0506974 3300049822 Bacteria 993
139 Ga0501045_0078584 3300049824 Bacteria 2432
140 nmdc:mga08y16_15024_c1 3300050511 Bacteria 8144
141 Ga0587085_001687 3300059506 Bacteria 2108
142 Ga0587117_006363 3300059627 Bacteria 1315
143 Ga0587062_009374 3300059639 Bacteria 1191
144 Ga0587062_009506 3300059639 Bacteria 1186
145 Ga0587119_002866 3300059658 Bacteria 1596
146 Ga0587119_029270 3300059658 Bacteria 745
147 Ga0501082_0232101 3300060353 Bacteria 1606
148 Ga0436361_0084709
149 Ga0070658_10387825
150 Ga0070683_100018093
151 Ga0068868_100040192
152 Ga0070674_100947974
153 Ga0070705_100512407
154 Ga0070708_101238541
155 Ga0070678_100091326
156 Ga0070678_100319097
157 Ga0070707_100134733
158 Ga0070707_100537670
159 Ga0070704_100453177
160 Ga0070702_100358801
161 Ga0068871_100153910
162 Ga0075430_100020511
163 Ga0075435_100122284
164 Ga0111539_10019553
165 Ga0105247_10001165
166 Ga0114129_11004095
167 Ga0105242_10023675
168 Ga0157379_11009330
169 Ga0157376_10315917
170 Ga0207642_10175410
171 Ga0207710_10000945
172 Ga0207646_10245807
173 Ga0207650_10749485
174 Ga0207686_10030272
175 Ga0207670_10007420
176 Ga0207704_10175570
177 Ga0207661_10831281
178 Ga0207667_10303917
179 Ga0207677_10026443
180 Ga0207639_10538703
181 Ga0207702_10100246
182 Ga0207641_10124607
183 Ga0207648_10014832
184 Ga0207676_10638772
185 Ga0207683_10007579
186 Ga0207683_10342144
187 Ga0207428_10073823
188 Ga0268264_10705134
189 Ga0265337_1024692
190 Ga0265326_10018756
191 Ga0265334_10100284
192 Ga0265323_10003056
193 Ga0265323_10006365
194 Ga0265323_10017581
195 Ga0265322_10006715
196 Ga0265322_10012513
197 Ga0307515_10132824
198 Ga0265338_10123938
199 Ga0265338_10246245
200 Ga0265338_10255216
201 Ga0265324_10001219
202 Ga0265330_10001249
203 Ga0265330_10030805
204 Ga0265330_10034500
205 Ga0265330_10132452
206 Ga0265332_10035572
207 Ga0265328_10021159
208 Ga0265325_10008542
209 Ga0265325_10023096
210 Ga0265329_10000177
211 Ga0265329_10000843
212 Ga0265329_10042969
213 Ga0265340_10270968
214 Ga0265339_10000006
215 Ga0265339_10164999
216 Ga0265339_10198000
217 Ga0265331_10029371
218 Ga0265316_10000020
219 Ga0265316_10000043
220 Ga0265316_10000138
221 Ga0265316_10009636
222 Ga0265316_10015542
223 Ga0265316_10022415
224 Ga0265316_10033888
225 Ga0265316_10037505
226 Ga0265316_10059494
227 Ga0265316_10133722
228 Ga0265313_10013771
229 Ga0265314_10000009
230 Ga0265314_10004821
231 Ga0265314_10013160
232 Ga0265342_10000061
233 Ga0265342_10001291
234 Ga0265342_10003357
235 Ga0265342_10036611
236 Ga0307406_10000716
237 Ga0373962_0052930
238 Ga0373935_0225915
239 Ga0373927_0018616
240 Ga0373925_0051655
241 Ga0373925_0054972
242 Ga0395905_0128222
243 Ga0439465_0014701
244 Ga0439431_0017409
245 Ga0439445_0002006
246 Ga0451577_0000029
247 Ga0451577_0036777
248 Ga0451577_0155660
249 Ga0451577_0542843
250 Ga0451577_0652512
251 Ga0451577_0718450
252 Ga0453683_0000253
253 Ga0453683_0001617
254 Ga0453683_0011409
255 Ga0453683_0014298
256 Ga0453684_0000088
257 Ga0453684_0000099
258 Ga0453684_0007369
259 Ga0453684_0020250
260 Ga0453684_0036721
261 Ga0453684_0056746
262 Ga0453684_0073306
263 Ga0453684_0074454
264 Ga0453684_0106498
265 Ga0453684_0180242
266 Ga0453684_0221990
267 Ga0453684_0457571
268 Ga0453684_0938387
269 Ga0453684_2240385
270 Ga0451576_0011719
271 Ga0451576_0138312
272 Ga0451576_0165382
273 Ga0451576_0168734
274 Ga0451576_0410411
275 Ga0451576_1043073
276 Ga0495668_0121219
277 Ga0496104_0201931
278 Ga0496110_0208099
279 Ga0496111_0737762
280 Ga0496126_0583068
281 Ga0501034_0029447
282 Ga0501036_0093006
283 Ga0501041_0116803
284 Ga0501075_0806249
285 Ga0501035_0506974
286 Ga0501045_0078584
287 nmdc:mga08y16_15024_c1
288 Ga0587085_001687
289 Ga0587117_006363
290 Ga0587062_009374
291 Ga0587062_009506
292 Ga0587119_002866
293 Ga0587119_029270
294 Ga0501082_0232101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

56

223

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z26-assembly1.cif.gz_A structure of pyrococcus furiosus argonaute with bound tungstate 0.7754 122 183
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.7655 79 182
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.7379 79 182
4rqa-assembly1.cif.gz_A crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (orthorhombic space group) 0.7229 147 189
1wxi-assembly1.cif.gz_A-2 e.coli nad synthetase, amp.pp 0.6789 125 183
ID Description Score Start End Superfamily
5esxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.822 147 184 3.40.50.2020
af_P87142_92_232_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7477 122 183 1.10.10.1740
af_P87142_25_211_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.736 122 183 3.30.420.40
af_Q6I5H2_178_325_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7317 150 188 3.40.50.300
af_Q9NF11_2_214_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7303 147 189 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A7Y5KZX2-F1-model_v4 Uncharacterized protein 0.8696 64 186
AF-A0A7X3ZCM6-F1-model_v4 Biopolymer transporter ExbD 0.8186 80 188 GO:0005886
GO:0015031
GO:0022857
AF-A0A4Y6PT35-F1-model_v4 Uncharacterized protein 0.8066 74 188
AF-A0A2T2SXZ2-F1-model_v4 Energy transducer TonB 0.802 80 185 GO:0015031
GO:0031992
GO:0055085
GO:0098797
AF-A0A7X3ZCM6-F1-model_v4 Biopolymer transporter ExbD 0.7988 80 188 GO:0005886
GO:0015031
GO:0022857

Map