F201020

General Info

Members Datasets Scaffolds Average Seq Length
147 71 294 372

Family's Representative Sequence

Representative Sequence 3300038725|Ga0400484_22386|Ga0400484_22386_6950_8140
Length 396
Sequence LKFGLVLVFNLQSLIIDYLIMMGKRKVRVGVIFGGRSGEHEVSLMSAQSVMDALDREKYEVIPIGIDKNGRWLSGDPMAALTEGYQGQAATLLPDPQSASLMQVEQGETQLATLSAVAELDVIFPVLHGTYGEDGTVQGLLELAGLPYVGAGVVGSAVGMDKAIFKHVMSANGIPVIPWKLYTSKDWAQRPSLILDEIETELGYPVFTKPANLGSSVGISKCDGRDNLARGMSEAAKYDRRIVVEKGINGRELEVAVLGNENPEASIVGEIRPRREFYDYFAKYMAEPDSEDESELIIPAELTPEQSEQVRTLAVEAYKAIDCGGLGRVDLMLDRDNGRLYMNEINTIPGFTRISMYPKLWEATGVSYPELLDKLIALALERYEDKSGLSTSFDIG

Samples

Sample ID Description Type Environment
1 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
23 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
31 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
32 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
33 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
34 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
35 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
36 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
37 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
38 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
39 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
43 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
44 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
45 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
46 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
49 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
52 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
53 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
54 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
65 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
66 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
67 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
68 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
69 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
70 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
71 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 2.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 91.84
Stem 0
Stem Tuber 0
Unclassified 8.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400484_22386 3300038725 Bacteria 8806
2 rootH1_10005457 3300003323 Bacteria 2512
3 Ga0070691_10009460 3300005341 Bacteria 4447
4 Ga0070713_100123214 3300005436 Bacteria 2276
5 Ga0070708_100043386 3300005445 Bacteria 3952
6 Ga0070708_100095044 3300005445 Bacteria 2720
7 Ga0070708_100136755 3300005445 Bacteria 2270
8 Ga0070681_10258555 3300005458 Bacteria 1653
9 Ga0070706_100002109 3300005467 Bacteria 20248
10 Ga0070706_100064106 3300005467 Bacteria 3396
11 Ga0070706_100391531 3300005467 Bacteria 1294
12 Ga0070707_100286227 3300005468 Bacteria 1601
13 Ga0070698_100137473 3300005471 Bacteria 2397
14 Ga0070698_100409185 3300005471 Bacteria 1290
15 Ga0070679_100005937 3300005530 Bacteria 11350
16 Ga0070679_100229924 3300005530 Bacteria 1814
17 Ga0070697_100000133 3300005536 Bacteria 59814
18 Ga0070697_100152057 3300005536 Bacteria 1951
19 Ga0070697_100180007 3300005536 Bacteria 1792
20 Ga0070697_100200990 3300005536 Bacteria 1694
21 Ga0068853_100068528 3300005539 Unclassified 3085
22 Ga0070665_100085274 3300005548 Bacteria 3164
23 Ga0068864_100058653 3300005618 Bacteria 3328
24 Ga0075431_100092492 3300006847 Bacteria 3122
25 Ga0075431_100109793 3300006847 Bacteria 2847
26 Ga0075433_10080950 3300006852 Bacteria 2863
27 Ga0075429_100292508 3300006880 Bacteria 1426
28 Ga0075436_100106452 3300006914 Bacteria 1956
29 Ga0114129_10094975 3300009147 Bacteria 4129
30 Ga0157372_10136164 3300013307 Bacteria 2828
31 Ga0157372_10364024 3300013307 Bacteria 1685
32 Ga0157380_10327082 3300014326 Bacteria 1424
33 Ga0213874_10000592 3300021377 Bacteria 7291
34 Ga0224712_10005862 3300022467 Bacteria 3460
35 Ga0207684_10008375 3300025910 Bacteria 9191
36 Ga0207707_10265704 3300025912 Bacteria 1488
37 Ga0207652_10005994 3300025921 Bacteria 9833
38 Ga0207650_10274927 3300025925 Bacteria 1370
39 Ga0207639_10061959 3300026041 Bacteria 2891
40 Ga0207676_10139891 3300026095 Bacteria 2071
41 Ga0265318_10005660 3300028577 Bacteria 5846
42 Ga0265320_10080995 3300031240 Bacteria 1515
43 Ga0265340_10073756 3300031247 Bacteria 1614
44 Ga0265331_10009161 3300031250 Bacteria 5582
45 Ga0307508_10066204 3300031616 Bacteria 3182
46 Ga0316575_10016158 3300031665 Bacteria 2821
47 Ga0316579_10000455 3300031691 Bacteria 13163
48 Ga0316579_10019584 3300031691 Bacteria 2991
49 Ga0316579_10041361 3300031691 Bacteria 2140
50 Ga0316579_10067016 3300031691 Bacteria 1696
51 Ga0316579_10109245 3300031691 Bacteria 1327
52 Ga0316576_10001059 3300031727 Bacteria 14292
53 Ga0316576_10015917 3300031727 Bacteria 5062
54 Ga0316576_10028101 3300031727 Bacteria 3961
55 Ga0316576_10035080 3300031727 Bacteria 3579
56 Ga0316576_10039239 3300031727 Bacteria 3398
57 Ga0316576_10072494 3300031727 Bacteria 2542
58 Ga0316576_10099048 3300031727 Unclassified 2177
59 Ga0316578_10000917 3300031728 Bacteria 11147
60 Ga0316578_10001898 3300031728 Bacteria 8837
61 Ga0316578_10007007 3300031728 Bacteria 5611
62 Ga0316578_10014139 3300031728 Unclassified 4254
63 Ga0316578_10020103 3300031728 Bacteria 3685
64 Ga0316578_10041847 3300031728 Bacteria 2654
65 Ga0316577_10000316 3300031733 Bacteria 17687
66 Ga0316577_10001264 3300031733 Bacteria 11810
67 Ga0316577_10002084 3300031733 Bacteria 9778
68 Ga0316577_10003338 3300031733 Bacteria 8094
69 Ga0316577_10004429 3300031733 Bacteria 7247
70 Ga0316577_10016239 3300031733 Bacteria 4101
71 Ga0316577_10017008 3300031733 Unclassified 4013
72 Ga0316577_10023658 3300031733 Bacteria 3411
73 Ga0316577_10025393 3300031733 Bacteria 3296
74 Ga0316577_10142653 3300031733 Bacteria 1349
75 Ga0307409_100025927 3300031995 Bacteria 4123
76 Ga0307415_100208581 3300032126 Bacteria 1557
77 Ga0316583_10000186 3300032133 Bacteria 16009
78 Ga0316585_10000110 3300032137 Bacteria 15059
79 Ga0316585_10007071 3300032137 Bacteria 3224
80 Ga0316580_10000073 3300032139 Bacteria 17222
81 Ga0316580_10002783 3300032139 Bacteria 4875
82 Ga0307507_10165852 3300033179 Bacteria 1619
83 Ga0316596_1000290 3300033541 Bacteria 7906
84 Ga0316596_1034512 3300033541 Unclassified 1321
85 Ga0316574_0003580 3300035398 Bacteria 8035
86 Ga0316574_0010055 3300035398 Bacteria 5326
87 Ga0316574_0047498 3300035398 Unclassified 2664
88 Ga0316574_0049547 3300035398 Bacteria 2612
89 Ga0373933_0001002 3300035724 Bacteria 17213
90 Ga0373933_0008228 3300035724 Bacteria 5691
91 Ga0316582_0000032 3300036647 Bacteria 32662
92 Ga0316582_0000076 3300036647 Bacteria 25350
93 Ga0316582_0000578 3300036647 Bacteria 14145
94 Ga0316582_0000869 3300036647 Bacteria 12330
95 Ga0316582_0003000 3300036647 Bacteria 8132
96 Ga0316582_0010854 3300036647 Bacteria 5008
97 Ga0316582_0018057 3300036647 Bacteria 4097
98 Ga0316582_0018430 3300036647 Bacteria 4064
99 Ga0316582_0056194 3300036647 Unclassified 2510
100 Ga0316582_0148605 3300036647 Bacteria 1583
101 Ga0316584_0000198 3300036712 Bacteria 29575
102 Ga0316584_0006581 3300036712 Bacteria 7870
103 Ga0316584_0014587 3300036712 Bacteria 5599
104 Ga0316584_0014619 3300036712 Bacteria 5594
105 Ga0316584_0021945 3300036712 Unclassified 4649
106 Ga0316584_0023882 3300036712 Unclassified 4468
107 Ga0316584_0049708 3300036712 Bacteria 3135
108 Ga0316584_0077840 3300036712 Bacteria 2484
109 Ga0316584_0102002 3300036712 Bacteria 2149
110 Ga0316584_0143443 3300036712 Bacteria 1780
111 Ga0316584_0149453 3300036712 Bacteria 1739
112 Ga0316584_0149692 3300036712 Bacteria 1738
113 Ga0316584_0156517 3300036712 Unclassified 1694
114 Ga0316581_0002237 3300037588 Bacteria 4577
115 Ga0316581_0009178 3300037588 Unclassified 2712
116 Ga0316581_0013062 3300037588 Unclassified 2349
117 Ga0436364_0129820 3300037853 Bacteria 2563
118 Ga0436364_0664947 3300037853 Bacteria 1663
119 Ga0400490_32888 3300038726 Bacteria 2272
120 Ga0400489_71325 3300039093 Unclassified 2930
121 Ga0400489_73801 3300039093 Bacteria 106363
122 Ga0400489_95368 3300039093 Bacteria 2606
123 Ga0436363_0633813 3300039450 Bacteria 11169
124 Ga0436362_0207229 3300039453 Bacteria 2015
125 Ga0451577_0005808 3300042876 Bacteria 12499
126 Ga0451577_0374545 3300042876 Bacteria 1292
127 Ga0453683_0116350 3300044673 Bacteria 1682
128 Ga0453683_0242833 3300044673 Bacteria 1147
129 Ga0453684_0000541 3300044712 Bacteria 143452
130 Ga0453684_0007259 3300044712 Bacteria 20517
131 Ga0453684_0051932 3300044712 Bacteria 5366
132 Ga0453684_0119516 3300044712 Bacteria 3185
133 Ga0453684_0215689 3300044712 Bacteria 2227
134 Ga0453684_0492670 3300044712 Bacteria 1358
135 Ga0466957_0008504 3300044842 Bacteria 5840
136 Ga0501034_0108023 3300049571 Bacteria 2774
137 Ga0501037_0053955 3300049573 Bacteria 2940
138 Ga0501047_0025680 3300049581 Bacteria 5665
139 Ga0501044_0006135 3300049823 Bacteria 13271
140 nmdc:mga05p37_93160_c1 3300050507 Bacteria 3712
141 nmdc:mga09592_230153_c1 3300050508 Bacteria 1606
142 nmdc:mga0qj67_121885_c1 3300050509 Bacteria 2109
143 nmdc:mga06r32_86093_c1 3300050510 Bacteria 3065
144 nmdc:mga08x19_80468_c1 3300050514 Bacteria 2138
145 nmdc:mga08x19_97143_c1 3300050514 Bacteria 1950
146 nmdc:mga0a205_92155_c1 3300050515 Bacteria 2928
147 Ga0530510_0000165 3300061734 Bacteria 39928
148 Ga0400484_22386
149 rootH1_10005457
150 Ga0070691_10009460
151 Ga0070713_100123214
152 Ga0070708_100043386
153 Ga0070708_100095044
154 Ga0070708_100136755
155 Ga0070681_10258555
156 Ga0070706_100002109
157 Ga0070706_100064106
158 Ga0070706_100391531
159 Ga0070707_100286227
160 Ga0070698_100137473
161 Ga0070698_100409185
162 Ga0070679_100005937
163 Ga0070679_100229924
164 Ga0070697_100000133
165 Ga0070697_100152057
166 Ga0070697_100180007
167 Ga0070697_100200990
168 Ga0068853_100068528
169 Ga0070665_100085274
170 Ga0068864_100058653
171 Ga0075431_100092492
172 Ga0075431_100109793
173 Ga0075433_10080950
174 Ga0075429_100292508
175 Ga0075436_100106452
176 Ga0114129_10094975
177 Ga0157372_10136164
178 Ga0157372_10364024
179 Ga0157380_10327082
180 Ga0213874_10000592
181 Ga0224712_10005862
182 Ga0207684_10008375
183 Ga0207707_10265704
184 Ga0207652_10005994
185 Ga0207650_10274927
186 Ga0207639_10061959
187 Ga0207676_10139891
188 Ga0265318_10005660
189 Ga0265320_10080995
190 Ga0265340_10073756
191 Ga0265331_10009161
192 Ga0307508_10066204
193 Ga0316575_10016158
194 Ga0316579_10000455
195 Ga0316579_10019584
196 Ga0316579_10041361
197 Ga0316579_10067016
198 Ga0316579_10109245
199 Ga0316576_10001059
200 Ga0316576_10015917
201 Ga0316576_10028101
202 Ga0316576_10035080
203 Ga0316576_10039239
204 Ga0316576_10072494
205 Ga0316576_10099048
206 Ga0316578_10000917
207 Ga0316578_10001898
208 Ga0316578_10007007
209 Ga0316578_10014139
210 Ga0316578_10020103
211 Ga0316578_10041847
212 Ga0316577_10000316
213 Ga0316577_10001264
214 Ga0316577_10002084
215 Ga0316577_10003338
216 Ga0316577_10004429
217 Ga0316577_10016239
218 Ga0316577_10017008
219 Ga0316577_10023658
220 Ga0316577_10025393
221 Ga0316577_10142653
222 Ga0307409_100025927
223 Ga0307415_100208581
224 Ga0316583_10000186
225 Ga0316585_10000110
226 Ga0316585_10007071
227 Ga0316580_10000073
228 Ga0316580_10002783
229 Ga0307507_10165852
230 Ga0316596_1000290
231 Ga0316596_1034512
232 Ga0316574_0003580
233 Ga0316574_0010055
234 Ga0316574_0047498
235 Ga0316574_0049547
236 Ga0373933_0001002
237 Ga0373933_0008228
238 Ga0316582_0000032
239 Ga0316582_0000076
240 Ga0316582_0000578
241 Ga0316582_0000869
242 Ga0316582_0003000
243 Ga0316582_0010854
244 Ga0316582_0018057
245 Ga0316582_0018430
246 Ga0316582_0056194
247 Ga0316582_0148605
248 Ga0316584_0000198
249 Ga0316584_0006581
250 Ga0316584_0014587
251 Ga0316584_0014619
252 Ga0316584_0021945
253 Ga0316584_0023882
254 Ga0316584_0049708
255 Ga0316584_0077840
256 Ga0316584_0102002
257 Ga0316584_0143443
258 Ga0316584_0149453
259 Ga0316584_0149692
260 Ga0316584_0156517
261 Ga0316581_0002237
262 Ga0316581_0009178
263 Ga0316581_0013062
264 Ga0436364_0129820
265 Ga0436364_0664947
266 Ga0400490_32888
267 Ga0400489_71325
268 Ga0400489_73801
269 Ga0400489_95368
270 Ga0436363_0633813
271 Ga0436362_0207229
272 Ga0451577_0005808
273 Ga0451577_0374545
274 Ga0453683_0116350
275 Ga0453683_0242833
276 Ga0453684_0000541
277 Ga0453684_0007259
278 Ga0453684_0051932
279 Ga0453684_0119516
280 Ga0453684_0215689
281 Ga0453684_0492670
282 Ga0466957_0008504
283 Ga0501034_0108023
284 Ga0501037_0053955
285 Ga0501047_0025680
286 Ga0501044_0006135
287 nmdc:mga05p37_93160_c1
288 nmdc:mga09592_230153_c1
289 nmdc:mga0qj67_121885_c1
290 nmdc:mga06r32_86093_c1
291 nmdc:mga08x19_80468_c1
292 nmdc:mga08x19_97143_c1
293 nmdc:mga0a205_92155_c1
294 Ga0530510_0000165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

168

377

0.97

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

28

151

0.83

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

161

368

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3se7-assembly1.cif.gz_B ancient vana 0.9346 10 364
4c5b-assembly1.cif.gz_A the x-ray crystal structure of d-alanyl-d-alanine ligase in complex with atp and d-ala-d-ala 0.9306 10 361
3se7-assembly1.cif.gz_B ancient vana 0.9291 10 364
1iow-assembly1.cif.gz_A complex of y216f d-ala:d-ala ligase with adp and a phosphoryl phosphinate 0.9283 10 361
3se7-assembly3.cif.gz_F ancient vana 0.9249 10 363
ID Description Score Start End Superfamily
3k3pA03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9704 165 236 3.30.1490.20
2i8cA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9461 138 372 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9448 138 361 3.30.470.20
1ehiA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9447 239 370 3.30.470.20
3n8dB03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9438 165 236 3.30.1490.20
ID Description Score Start End GO Terms
AF-A0A535FBX8-F1-model_v4 D-alanine--D-alanine ligase 0.9853 123 376 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A357CRR7-F1-model_v4 D-alanine--D-alanine ligase A 0.985 109 369 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A6V8PDS7-F1-model_v4 D-alanine-D-alanine ligase 0.9838 154 236 GO:0005524
GO:0005829
GO:0008716
GO:0009252
GO:0046872
AF-A0A535FBX8-F1-model_v4 D-alanine--D-alanine ligase 0.9815 123 376 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A7W0ZQ39-F1-model_v4 ATP-grasp domain-containing protein 0.9797 208 371 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872

Map