F200885

General Info

Members Datasets Scaffolds Average Seq Length
147 52 294 168

Family's Representative Sequence

Representative Sequence 3300032168|Ga0316593_10053438|Ga0316593_100534382
Length 178
Sequence MKRSDKQTIIDNLTQEINSYNHFYLADISNLNADKTSELRRLCFQKDVKLIVVKNTLLKKAIEASDKNADELFSTLKGNTSLMFCESGSIPAKLIQDFRKKNKSLNKPVFKAAYVEESVYIGENQLDALANIKSKEELIGDVIALLQSPAKNVISALQGGGGQKIVGILKTLSEKENK

Samples

Sample ID Description Type Environment
1 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
3 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
4 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
5 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
6 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
7 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
8 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
9 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
10 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
11 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
16 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
17 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
18 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
19 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
20 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
21 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
22 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
23 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
24 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
25 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
26 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
27 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
28 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 48.3
Metatranscriptomes 51.02
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.68
Rhizosphere 92.52
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316593_10053438 3300032168 Bacteria 1369
2 Ga0265323_10015327 3300028653 Unclassified 3018
3 Ga0265338_10002299 3300028800 Bacteria 29050
4 Ga0265316_10002116 3300031344 Bacteria 20863
5 Ga0265316_10015458 3300031344 Bacteria 6674
6 Ga0265316_10137727 3300031344 Bacteria 1836
7 Ga0265316_10262679 3300031344 Bacteria 1265
8 Ga0316579_10022585 3300031691 Bacteria 2815
9 Ga0316579_10250934 3300031691 Bacteria 856
10 Ga0316576_10012743 3300031727 Bacteria 5562
11 Ga0316576_10017290 3300031727 Bacteria 4895
12 Ga0316576_10018301 3300031727 Bacteria 4780
13 Ga0316576_10080691 3300031727 Bacteria 2413
14 Ga0316576_10096258 3300031727 Bacteria 2209
15 Ga0316576_10313080 3300031727 Bacteria 1172
16 Ga0316578_10001198 3300031728 Bacteria 10296
17 Ga0316578_10049351 3300031728 Bacteria 2459
18 Ga0316577_10003141 3300031733 Bacteria 8302
19 Ga0316585_10011741 3300032137 Bacteria 2586
20 Ga0316580_10042524 3300032139 Bacteria 1402
21 Ga0316593_10000991 3300032168 Bacteria 5875
22 Ga0316593_10001317 3300032168 Bacteria 5411
23 Ga0316593_10001424 3300032168 Bacteria 5268
24 Ga0316593_10007056 3300032168 Bacteria 3067
25 Ga0316593_10022191 3300032168 Bacteria 1993
26 Ga0316593_10023475 3300032168 Bacteria 1946
27 Ga0316593_10050474 3300032168 Bacteria 1404
28 Ga0316593_10054423 3300032168 Bacteria 1358
29 Ga0316593_10067791 3300032168 Bacteria 1230
30 Ga0316593_10185156 3300032168 Bacteria 766
31 Ga0316592_1000238 3300033524 Bacteria 6773
32 Ga0316592_1000944 3300033524 Bacteria 4451
33 Ga0316592_1005390 3300033524 Bacteria 2427
34 Ga0316592_1013747 3300033524 Bacteria 1674
35 Ga0316592_1040703 3300033524 Bacteria 1028
36 Ga0316592_1098288 3300033524 Bacteria 672
37 Ga0316586_1003309 3300033527 Bacteria 2104
38 Ga0316588_1001715 3300033528 Bacteria 3675
39 Ga0316588_1015630 3300033528 Bacteria 1674
40 Ga0316588_1016147 3300033528 Bacteria 1651
41 Ga0316596_1000258 3300033541 Bacteria 8189
42 Ga0316596_1000366 3300033541 Bacteria 7418
43 Ga0316596_1000863 3300033541 Bacteria 5687
44 Ga0316596_1000933 3300033541 Bacteria 5561
45 Ga0316596_1003631 3300033541 Bacteria 3400
46 Ga0316596_1004659 3300033541 Bacteria 3093
47 Ga0316596_1009752 3300033541 Bacteria 2308
48 Ga0316596_1012889 3300033541 Bacteria 2060
49 Ga0316596_1016159 3300033541 Bacteria 1868
50 Ga0316596_1017392 3300033541 Bacteria 1808
51 Ga0316596_1022724 3300033541 Bacteria 1604
52 Ga0316596_1029575 3300033541 Unclassified 1418
53 Ga0316596_1031644 3300033541 Bacteria 1375
54 Ga0316596_1044963 3300033541 Bacteria 1164
55 Ga0316596_1049425 3300033541 Bacteria 1112
56 Ga0316596_1104382 3300033541 Bacteria 767
57 Ga0316574_0105531 3300035398 Bacteria 1805
58 Ga0316582_0005208 3300036647 Bacteria 6663
59 Ga0316582_0035511 3300036647 Bacteria 3079
60 Ga0316582_0412848 3300036647 Bacteria 930
61 Ga0316584_0000096 3300036712 Bacteria 35816
62 Ga0316584_0001736 3300036712 Bacteria 13379
63 Ga0316584_0165520 3300036712 Unclassified 1642
64 Ga0400483_029390 3300039062 Bacteria 48364
65 Ga0400483_226961 3300039062 Bacteria 47833
66 Ga0400489_04995 3300039093 Bacteria 1028
67 Ga0400489_08682 3300039093 Bacteria 3165
68 Ga0400487_57383 3300039110 Bacteria 1387
69 Ga0451795_0531346 3300041456 Bacteria 3201
70 Ga0451852_03295 3300041508 Bacteria 1293
71 Ga0451852_06373 3300041508 Bacteria 3000
72 Ga0451852_44034 3300041508 Bacteria 2681
73 Ga0451855_0911133 3300041511 Bacteria 639
74 Ga0451577_0006903 3300042876 Bacteria 11227
75 Ga0451577_0012082 3300042876 Bacteria 8123
76 Ga0451577_0018384 3300042876 Bacteria 6440
77 Ga0451577_0075376 3300042876 Bacteria 3008
78 Ga0451577_0075809 3300042876 Bacteria 2999
79 Ga0451577_0304092 3300042876 Bacteria 1445
80 Ga0451577_0700182 3300042876 Bacteria 917
81 Ga0453683_0000135 3300044673 Bacteria 107930
82 Ga0453683_0014479 3300044673 Bacteria 5118
83 Ga0453683_0046895 3300044673 Bacteria 2708
84 Ga0453683_0124311 3300044673 Bacteria 1624
85 Ga0453683_0400632 3300044673 Bacteria 884
86 Ga0453684_0000553 3300044712 Bacteria 141396
87 Ga0453684_0000779 3300044712 Bacteria 109902
88 Ga0453684_0001022 3300044712 Bacteria 89958
89 Ga0453684_0001284 3300044712 Bacteria 74993
90 Ga0453684_0001358 3300044712 Bacteria 71434
91 Ga0453684_0001653 3300044712 Bacteria 60468
92 Ga0453684_0001891 3300044712 Bacteria 54349
93 Ga0453684_0011537 3300044712 Bacteria 14783
94 Ga0453684_0079408 3300044712 Bacteria 4102
95 Ga0453684_0127128 3300044712 Bacteria 3065
96 Ga0453684_0235371 3300044712 Bacteria 2112
97 Ga0453684_0486988 3300044712 Bacteria 1368
98 Ga0453684_0548453 3300044712 Bacteria 1274
99 Ga0453684_0833216 3300044712 Bacteria 992
100 Ga0453684_1034033 3300044712 Bacteria 872
101 Ga0453684_1169659 3300044712 Bacteria 809
102 Ga0453684_1979659 3300044712 Unclassified 587
103 Ga0451576_0000112 3300045051 Bacteria 209574
104 Ga0451576_0009435 3300045051 Bacteria 11311
105 Ga0451576_0010553 3300045051 Bacteria 10581
106 Ga0451576_0013829 3300045051 Bacteria 9016
107 Ga0451576_0017971 3300045051 Bacteria 7759
108 Ga0451576_0062300 3300045051 Bacteria 3888
109 Ga0451576_0093089 3300045051 Bacteria 3134
110 Ga0451576_0260347 3300045051 Bacteria 1813
111 Ga0451576_0417797 3300045051 Unclassified 1407
112 Ga0501306_068906 3300049127 Bacteria 594
113 Ga0501308_003039 3300049128 Bacteria 1523
114 Ga0501308_006615 3300049128 Bacteria 1193
115 Ga0501345_00281 3300049134 Bacteria 1586
116 Ga0501304_001899 3300049160 Bacteria 1399
117 Ga0501304_002036 3300049160 Bacteria 1368
118 Ga0501305_000794 3300049161 Bacteria 2794
119 Ga0501305_059321 3300049161 Bacteria 656
120 Ga0501307_000909 3300049162 Bacteria 2272
121 Ga0501307_053828 3300049162 Bacteria 610
122 Ga0501311_020025 3300049527 Bacteria 902
123 Ga0501311_087584 3300049527 Bacteria 537
124 Ga0501312_002435 3300049528 Bacteria 2009
125 Ga0501313_000829 3300049529 Bacteria 2374
126 Ga0501315_006507 3300049531 Bacteria 1303
127 Ga0501315_055701 3300049531 Bacteria 630
128 Ga0501316_007908 3300049532 Bacteria 1164
129 Ga0501316_022395 3300049532 Bacteria 805
130 Ga0501317_003037 3300049533 Bacteria 1639
131 Ga0501318_087910 3300049534 Bacteria 511
132 Ga0501320_001423 3300049536 Bacteria 1758
133 Ga0501320_033824 3300049536 Bacteria 646
134 Ga0501321_055483 3300049537 Bacteria 588
135 Ga0501321_069057 3300049537 Bacteria 547
136 Ga0501329_09797 3300049545 Bacteria 593
137 Ga0501330_022256 3300049546 Bacteria 515
138 Ga0501333_000591 3300049549 Bacteria 1729
139 Ga0501335_002252 3300049551 Bacteria 1553
140 Ga0501336_000259 3300049552 Bacteria 2405
141 Ga0501336_021136 3300049552 Bacteria 593
142 Ga0501336_030334 3300049552 Bacteria 529
143 Ga0501337_007042 3300049553 Bacteria 778
144 Ga0501339_00335 3300049555 Bacteria 927
145 Ga0501340_000690 3300049556 Bacteria 1597
146 Ga0587093_046756 3300059478 Bacteria 672
147 2839990136 2839989709 Bacteria 3773432
148 Ga0316593_10053438
149 Ga0265323_10015327
150 Ga0265338_10002299
151 Ga0265316_10002116
152 Ga0265316_10015458
153 Ga0265316_10137727
154 Ga0265316_10262679
155 Ga0316579_10022585
156 Ga0316579_10250934
157 Ga0316576_10012743
158 Ga0316576_10017290
159 Ga0316576_10018301
160 Ga0316576_10080691
161 Ga0316576_10096258
162 Ga0316576_10313080
163 Ga0316578_10001198
164 Ga0316578_10049351
165 Ga0316577_10003141
166 Ga0316585_10011741
167 Ga0316580_10042524
168 Ga0316593_10000991
169 Ga0316593_10001317
170 Ga0316593_10001424
171 Ga0316593_10007056
172 Ga0316593_10022191
173 Ga0316593_10023475
174 Ga0316593_10050474
175 Ga0316593_10054423
176 Ga0316593_10067791
177 Ga0316593_10185156
178 Ga0316592_1000238
179 Ga0316592_1000944
180 Ga0316592_1005390
181 Ga0316592_1013747
182 Ga0316592_1040703
183 Ga0316592_1098288
184 Ga0316586_1003309
185 Ga0316588_1001715
186 Ga0316588_1015630
187 Ga0316588_1016147
188 Ga0316596_1000258
189 Ga0316596_1000366
190 Ga0316596_1000863
191 Ga0316596_1000933
192 Ga0316596_1003631
193 Ga0316596_1004659
194 Ga0316596_1009752
195 Ga0316596_1012889
196 Ga0316596_1016159
197 Ga0316596_1017392
198 Ga0316596_1022724
199 Ga0316596_1029575
200 Ga0316596_1031644
201 Ga0316596_1044963
202 Ga0316596_1049425
203 Ga0316596_1104382
204 Ga0316574_0105531
205 Ga0316582_0005208
206 Ga0316582_0035511
207 Ga0316582_0412848
208 Ga0316584_0000096
209 Ga0316584_0001736
210 Ga0316584_0165520
211 Ga0400483_029390
212 Ga0400483_226961
213 Ga0400489_04995
214 Ga0400489_08682
215 Ga0400487_57383
216 Ga0451795_0531346
217 Ga0451852_03295
218 Ga0451852_06373
219 Ga0451852_44034
220 Ga0451855_0911133
221 Ga0451577_0006903
222 Ga0451577_0012082
223 Ga0451577_0018384
224 Ga0451577_0075376
225 Ga0451577_0075809
226 Ga0451577_0304092
227 Ga0451577_0700182
228 Ga0453683_0000135
229 Ga0453683_0014479
230 Ga0453683_0046895
231 Ga0453683_0124311
232 Ga0453683_0400632
233 Ga0453684_0000553
234 Ga0453684_0000779
235 Ga0453684_0001022
236 Ga0453684_0001284
237 Ga0453684_0001358
238 Ga0453684_0001653
239 Ga0453684_0001891
240 Ga0453684_0011537
241 Ga0453684_0079408
242 Ga0453684_0127128
243 Ga0453684_0235371
244 Ga0453684_0486988
245 Ga0453684_0548453
246 Ga0453684_0833216
247 Ga0453684_1034033
248 Ga0453684_1169659
249 Ga0453684_1979659
250 Ga0451576_0000112
251 Ga0451576_0009435
252 Ga0451576_0010553
253 Ga0451576_0013829
254 Ga0451576_0017971
255 Ga0451576_0062300
256 Ga0451576_0093089
257 Ga0451576_0260347
258 Ga0451576_0417797
259 Ga0501306_068906
260 Ga0501308_003039
261 Ga0501308_006615
262 Ga0501345_00281
263 Ga0501304_001899
264 Ga0501304_002036
265 Ga0501305_000794
266 Ga0501305_059321
267 Ga0501307_000909
268 Ga0501307_053828
269 Ga0501311_020025
270 Ga0501311_087584
271 Ga0501312_002435
272 Ga0501313_000829
273 Ga0501315_006507
274 Ga0501315_055701
275 Ga0501316_007908
276 Ga0501316_022395
277 Ga0501317_003037
278 Ga0501318_087910
279 Ga0501320_001423
280 Ga0501320_033824
281 Ga0501321_055483
282 Ga0501321_069057
283 Ga0501329_09797
284 Ga0501330_022256
285 Ga0501333_000591
286 Ga0501335_002252
287 Ga0501336_000259
288 Ga0501336_021136
289 Ga0501336_030334
290 Ga0501337_007042
291 Ga0501339_00335
292 Ga0501340_000690
293 Ga0587093_046756
294 2839990136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

1

100

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ug7-assembly1.cif.gz_LJ 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.9066 2 129
7as8-assembly1.cif.gz_L bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9062 4 128
8phj-assembly1.cif.gz_5 ca4-bound cami1 in complex with 70s ribosome 0.9001 1 130
5zeb-assembly1.cif.gz_I m. smegmatis p/p state 70s ribosome structure 0.8976 1 129
5gad-assembly1.cif.gz_I rnc-srp-sr complex early state 0.8961 1 126
ID Description Score Start End Superfamily
5oolI00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8876 6 129 3.30.70.1730
af_Q9VPL3_26_196_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8764 1 129 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8576 1 132 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8517 1 132 3.30.70.1730
1zaxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8464 3 129 3.30.70.1730
ID Description Score Start End GO Terms
AF-A0A0R2S5T3-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9874 1 131 GO:0005840
GO:1990904
AF-A0A497CSE5-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9842 1 117 GO:0005840
GO:1990904
AF-A0A520A2J2-F1-model_v4 50S ribosomal protein L10 0.9839 1 124 GO:0003735
GO:0006412
GO:0015934
AF-A0A521IKC9-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9817 1 108 GO:0005840
GO:1990904
AF-A0A0R2S5T3-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.98 1 131 GO:0005840
GO:1990904

Map