F200338

General Info

Members Datasets Scaffolds Average Seq Length
147 110 135 193

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10043518|Ga0157371_100435183
Length 220
Sequence MKRKKIIKTNHRLLNLLMQTDDWEMETIDIKTHHKGLDPHRWVSNYADYLYTFAVFRVNDEELAQDLVQETFLAALQRVEKFEGRCTEKTWLTAILKNKIIDVYRSKSSGLAKGAVAPAPEDGDTDFFDHDDGHWNDAHRPARLGIEQPDALENKEFQKILQACMKKLPALWLSVFTMKHVDEEATDVICRELKVTSSNFWVIIHRAKVNLRSCLQRNWI

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
4 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
5 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
6 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
10 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
11 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
12 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
73 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
74 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
75 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
76 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
109 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
110 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.84
Metatranscriptomes 0
Isolates 8.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.48
Nodule 0
Rhizoplane 0.68
Rhizosphere 80.27
Stem 0
Stem Tuber 0
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000084 3300002067 Bacteria 35383
2 JGI25162J39368_1000016 3300002737 Bacteria 288734
3 rootH1_10017112 3300003316 Bacteria 7390
4 rootH2_10215592 3300003320 Bacteria 2312
5 rootL2_10140154 3300003322 Bacteria 5499
6 rootH1_10015840 3300003323 Bacteria 24647
7 Ga0055531_10000327 3300003794 Bacteria 46934
8 Ga0065165_1014947 3300005262 Bacteria 2987
9 Ga0065714_10004821 3300005288 Bacteria 7216
10 Ga0070658_10154455 3300005327 Unclassified 1923
11 Ga0070658_10184573 3300005327 Bacteria 1756
12 Ga0070658_10441812 3300005327 Bacteria 1120
13 Ga0070660_100103929 3300005339 Bacteria 2253
14 Ga0070668_100317630 3300005347 Bacteria 1310
15 Ga0070675_100908995 3300005354 Bacteria 807
16 Ga0070659_100000154 3300005366 Bacteria 52564
17 Ga0070681_10067473 3300005458 Bacteria 3545
18 Ga0068867_100523530 3300005459 Bacteria 1023
19 Ga0068853_100073967 3300005539 Bacteria 2972
20 Ga0070665_100000006 3300005548 Bacteria 718034
21 Ga0068855_100002062 3300005563 Bacteria 24904
22 Ga0068855_100446882 3300005563 Bacteria 1411
23 Ga0070664_100877828 3300005564 Bacteria 840
24 Ga0068857_100348567 3300005577 Bacteria 1371
25 Ga0068856_100043402 3300005614 Bacteria 4424
26 Ga0068856_100713199 3300005614 Bacteria 1023
27 Ga0068852_101361955 3300005616 Unclassified 731
28 Ga0075366_10027376 3300006195 Bacteria 3344
29 Ga0105240_10258393 3300009093 Bacteria 2010
30 Ga0105240_10307474 3300009093 Bacteria 1812
31 Ga0105241_10353899 3300009174 Bacteria 1276
32 Ga0105237_10001662 3300009545 Bacteria 28876
33 Ga0105237_10014099 3300009545 Bacteria 8362
34 Ga0105237_10896227 3300009545 Bacteria 894
35 Ga0105238_10226531 3300009551 Bacteria 1846
36 Ga0105238_10277262 3300009551 Bacteria 1657
37 Ga0105238_10826859 3300009551 Unclassified 943
38 Ga0105249_10418127 3300009553 Bacteria 1374
39 Ga0105249_10511491 3300009553 Bacteria 1247
40 Ga0105239_10000014 3300010375 Bacteria 325391
41 Ga0105239_10000186 3300010375 Bacteria 90998
42 Ga0105239_10089486 3300010375 Bacteria 3394
43 Ga0157371_10000192 3300013102 Bacteria 90362
44 Ga0157371_10034044 3300013102 Bacteria 3658
45 Ga0157371_10043518 3300013102 Bacteria 3198
46 Ga0157370_10162730 3300013104 Bacteria 2076
47 Ga0157369_10096572 3300013105 Bacteria 3152
48 Ga0157374_10066751 3300013296 Bacteria 3381
49 Ga0157374_10159177 3300013296 Bacteria 2199
50 Ga0163162_10008316 3300013306 Bacteria 10124
51 Ga0163162_10025955 3300013306 Bacteria 5790
52 Ga0163162_10119854 3300013306 Bacteria 2734
53 Ga0157372_10011278 3300013307 Bacteria 9508
54 Ga0157372_10417924 3300013307 Bacteria 1563
55 Ga0157379_10222059 3300014968 Bacteria 1712
56 Ga0182005_1000107 3300015265 Bacteria 60831
57 Ga0163161_10225646 3300017792 Unclassified 1452
58 Ga0209436_101424 3300025208 Bacteria 8396
59 Ga0209437_100262 3300025233 Bacteria 81344
60 Ga0209026_1000258 3300025250 Bacteria 65976
61 Ga0209026_1005044 3300025250 Bacteria 3688
62 Ga0209026_1006738 3300025250 Bacteria 2740
63 Ga0209257_1000005 3300025304 Bacteria 1592528
64 Ga0207647_10038189 3300025904 Bacteria 3037
65 Ga0207647_10114973 3300025904 Bacteria 1589
66 Ga0207705_10040953 3300025909 Bacteria 3323
67 Ga0207705_10058488 3300025909 Bacteria 2781
68 Ga0207707_10053541 3300025912 Bacteria 3513
69 Ga0207695_10187569 3300025913 Bacteria 1986
70 Ga0207695_10218800 3300025913 Bacteria 1812
71 Ga0207671_10002505 3300025914 Bacteria 19603
72 Ga0207671_10006194 3300025914 Bacteria 10741
73 Ga0207657_10109311 3300025919 Bacteria 2285
74 Ga0207694_10044494 3300025924 Bacteria 3428
75 Ga0207690_10001547 3300025932 Bacteria 14399
76 Ga0207667_10001302 3300025949 Bacteria 31255
77 Ga0207667_10108835 3300025949 Bacteria 2859
78 Ga0207712_10056557 3300025961 Bacteria 2764
79 Ga0207702_10078500 3300026078 Bacteria 2858
80 Ga0207702_10847074 3300026078 Bacteria 905
81 Ga0207648_10593348 3300026089 Bacteria 1020
82 Ga0207674_10068491 3300026116 Bacteria 3571
83 Ga0207698_10180341 3300026142 Bacteria 1870
84 Ga0268266_10000010 3300028379 Bacteria 1030233
85 Ga0307515_10104762 3300028794 Bacteria 3375
86 Ga0316177_1078711 3300030731 Bacteria 15195
87 Ga0316176_1066110 3300030732 Bacteria 5294
88 Ga0316183_1117238 3300030742 Bacteria 12876
89 Ga0316181_1029685 3300030744 Unclassified 2457
90 Ga0316181_1214260 3300030744 Bacteria 13251
91 Ga0316182_1117588 3300030745 Bacteria 2364
92 Ga0265327_10181156 3300031251 Bacteria 963
93 Ga0307414_10002272 3300032004 Bacteria 10031
94 Ga0307414_10017234 3300032004 Bacteria 4414
95 Ga0307414_10041943 3300032004 Unclassified 3105
96 Ga0451577_0171373 3300042876 Unclassified 1956
97 Ga0495650_0000095 3300046471 Bacteria 218020
98 Ga0495585_0000057 3300046492 Bacteria 113069
99 Ga0495583_0057173 3300046506 Bacteria 1755
100 Ga0495606_0000009 3300046507 Bacteria 306313
101 Ga0495610_0000884 3300046512 Bacteria 27878
102 Ga0495610_0005897 3300046512 Bacteria 8583
103 Ga0495616_0003284 3300046513 Bacteria 10400
104 Ga0495609_0015004 3300046538 Bacteria 3630
105 Ga0495633_0004626 3300046558 Bacteria 8669
106 Ga0495633_0037075 3300046558 Bacteria 2334
107 Ga0495625_0000007 3300046660 Bacteria 565749
108 Ga0495625_0134140 3300046660 Bacteria 1675
109 Ga0495661_0004315 3300046665 Bacteria 10297
110 Ga0495661_0019032 3300046665 Bacteria 4503
111 Ga0495649_0000007 3300046694 Bacteria 518037
112 Ga0495687_000206 3300047443 Bacteria 84323
113 Ga0495687_007395 3300047443 Bacteria 6471
114 Ga0495686_0000267 3300047472 Bacteria 93355
115 Ga0495686_0000558 3300047472 Bacteria 53165
116 Ga0495686_0031884 3300047472 Bacteria 3414
117 Ga0495614_0020099 3300048089 Bacteria 2889
118 Ga0496121_0000043 3300048924 Bacteria 341882
119 Ga0501032_0002176 3300049569 Bacteria 15428
120 Ga0501034_0045586 3300049571 Bacteria 4430
121 Ga0501036_0039281 3300049572 Bacteria 4005
122 Ga0501037_0001536 3300049573 Bacteria 16838
123 Ga0501038_0009199 3300049574 Bacteria 9061
124 Ga0501039_0009461 3300049575 Bacteria 7429
125 Ga0501043_0009336 3300049579 Bacteria 7706
126 Ga0501046_0426851 3300049580 Unclassified 955
127 Ga0501047_0002459 3300049581 Bacteria 17689
128 Ga0501048_0580063 3300049582 Unclassified 805
129 Ga0501241_004112 3300049758 Unclassified 2731
130 Ga0501035_0017122 3300049822 Bacteria 6678
131 Ga0501044_0005431 3300049823 Bacteria 14157
132 nmdc:mga0k408_23015_c1 3300050493 Bacteria 3511
133 Ga0500635_0002702 3300053080 Bacteria 4399
134 Ga0500618_000073 3300053125 Bacteria 81706
135 Ga0500618_019342 3300053125 Bacteria 1677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10353899 Ga0105241_103538992 176
2 3300009545 Ga0105237_10896227 Ga0105237_108962272 176
3 3300003794 Ga0055531_10000327 Ga0055531_1000032752 180
4 3300025304 Ga0209257_1000005 Ga0209257_1000005132 180
5 3300005563 Ga0068855_100002062 Ga0068855_1000020628 183
6 3300025949 Ga0207667_10001302 Ga0207667_1000130231 183
7 3300005327 Ga0070658_10154455 Ga0070658_101544554 186
8 3300005327 Ga0070658_10441812 Ga0070658_104418121 186
9 3300009093 Ga0105240_10307474 Ga0105240_103074744 186
10 3300013296 Ga0157374_10066751 Ga0157374_100667513 186
11 3300013306 Ga0163162_10119854 Ga0163162_101198541 186
12 3300025250 Ga0209026_1005044 Ga0209026_10050442 186
13 3300025909 Ga0207705_10040953 Ga0207705_100409534 186
14 3300025909 Ga0207705_10058488 Ga0207705_100584881 186
15 3300025913 Ga0207695_10218800 Ga0207695_102188004 186
16 3300042876 Ga0451577_0171373 Ga0451577_0171373_713_1285 186
17 3300003323 rootH1_10015840 rootH1_1001584012 187
18 3300005327 Ga0070658_10184573 Ga0070658_101845733 187
19 3300005339 Ga0070660_100103929 Ga0070660_1001039292 187
20 3300005366 Ga0070659_100000154 Ga0070659_10000015442 187
21 3300005548 Ga0070665_100000006 Ga0070665_100000006424 187
22 3300005614 Ga0068856_100713199 Ga0068856_1007131992 187
23 3300009093 Ga0105240_10258393 Ga0105240_102583931 187
24 3300009545 Ga0105237_10014099 Ga0105237_100140995 187
25 3300009551 Ga0105238_10277262 Ga0105238_102772623 187
26 3300009553 Ga0105249_10418127 Ga0105249_104181273 187
27 3300010375 Ga0105239_10000014 Ga0105239_10000014271 187
28 3300010375 Ga0105239_10000186 Ga0105239_1000018631 187
29 3300013296 Ga0157374_10159177 Ga0157374_101591772 187
30 3300013306 Ga0163162_10008316 Ga0163162_100083164 187
31 3300014968 Ga0157379_10222059 Ga0157379_102220592 187
32 3300017792 Ga0163161_10225646 Ga0163161_102256462 187
33 3300025904 Ga0207647_10038189 Ga0207647_100381892 187
34 3300025913 Ga0207695_10187569 Ga0207695_101875693 187
35 3300025914 Ga0207671_10002505 Ga0207671_1000250514 187
36 3300025914 Ga0207671_10006194 Ga0207671_100061942 187
37 3300025919 Ga0207657_10109311 Ga0207657_101093112 187
38 3300025932 Ga0207690_10001547 Ga0207690_1000154711 187
39 3300025961 Ga0207712_10056557 Ga0207712_100565571 187
40 3300028379 Ga0268266_10000010 Ga0268266_10000010504 187
41 3300046660 Ga0495625_0134140 Ga0495625_0134140_1067_1630 187
42 iso_pu_bacteria 2599185184 2599481176 187
43 iso_pu_bacteria 2928078545 2928081769 187
44 iso_pu_bacteria 2928147474 2928151796 187
45 iso_pu_bacteria 2932082852 2932087106 187
46 3300005616 Ga0068852_101361955 Ga0068852_1013619552 188
47 3300009551 Ga0105238_10826859 Ga0105238_108268592 188
48 3300009553 Ga0105249_10511491 Ga0105249_105114913 188
49 3300013307 Ga0157372_10417924 Ga0157372_104179243 188
50 3300026078 Ga0207702_10847074 Ga0207702_108470741 188
51 3300026142 Ga0207698_10180341 Ga0207698_101803412 188
52 3300049569 Ga0501032_0002176 Ga0501032_0002176_7106_7675 188
53 3300049571 Ga0501034_0045586 Ga0501034_0045586_395_964 188
54 3300049572 Ga0501036_0039281 Ga0501036_0039281_572_1141 188
55 3300049573 Ga0501037_0001536 Ga0501037_0001536_13147_13716 188
56 3300049574 Ga0501038_0009199 Ga0501038_0009199_7842_8411 188
57 3300049575 Ga0501039_0009461 Ga0501039_0009461_3308_3877 188
58 3300049579 Ga0501043_0009336 Ga0501043_0009336_2837_3406 188
59 3300049580 Ga0501046_0426851 Ga0501046_0426851_329_898 188
60 3300049581 Ga0501047_0002459 Ga0501047_0002459_12842_13411 188
61 3300049582 Ga0501048_0580063 Ga0501048_0580063_28_597 188
62 3300049822 Ga0501035_0017122 Ga0501035_0017122_6011_6580 188
63 3300049823 Ga0501044_0005431 Ga0501044_0005431_562_1131 188
64 3300053080 Ga0500635_0002702 Ga0500635_0002702_2675_3244 188
65 3300005288 Ga0065714_10004821 Ga0065714_100048212 189
66 3300005563 Ga0068855_100446882 Ga0068855_1004468822 189
67 3300005564 Ga0070664_100877828 Ga0070664_1008778281 189
68 3300005577 Ga0068857_100348567 Ga0068857_1003485672 189
69 3300005614 Ga0068856_100043402 Ga0068856_1000434025 189
70 3300009545 Ga0105237_10001662 Ga0105237_100016625 189
71 3300009551 Ga0105238_10226531 Ga0105238_102265311 189
72 3300013104 Ga0157370_10162730 Ga0157370_101627302 189
73 3300025250 Ga0209026_1000258 Ga0209026_100025818 189
74 3300025250 Ga0209026_1006738 Ga0209026_10067384 189
75 3300025949 Ga0207667_10108835 Ga0207667_101088352 189
76 3300026078 Ga0207702_10078500 Ga0207702_100785003 189
77 3300026116 Ga0207674_10068491 Ga0207674_100684912 189
78 3300031251 Ga0265327_10181156 Ga0265327_101811561 189
79 3300046512 Ga0495610_0000884 Ga0495610_0000884_11952_12524 189
80 3300046558 Ga0495633_0037075 Ga0495633_0037075_647_1219 189
81 3300046665 Ga0495661_0019032 Ga0495661_0019032_1076_1648 189
82 3300047443 Ga0495687_000206 Ga0495687_000206_12731_13303 189
83 3300047472 Ga0495686_0000267 Ga0495686_0000267_32539_33150 189
84 3300047472 Ga0495686_0000558 Ga0495686_0000558_8454_9026 189
85 3300048089 Ga0495614_0020099 Ga0495614_0020099_160_732 189
86 3300002737 JGI25162J39368_1000016 JGI25162J39368_100001618 190
87 3300003316 rootH1_10017112 rootH1_100171123 190
88 3300005262 Ga0065165_1014947 Ga0065165_10149472 190
89 3300005347 Ga0070668_100317630 Ga0070668_1003176302 190
90 3300005354 Ga0070675_100908995 Ga0070675_1009089951 190
91 3300005458 Ga0070681_10067473 Ga0070681_100674733 190
92 3300005459 Ga0068867_100523530 Ga0068867_1005235301 190
93 3300013102 Ga0157371_10000192 Ga0157371_1000019245 190
94 3300013102 Ga0157371_10043518 Ga0157371_100435183 190
95 3300015265 Ga0182005_1000107 Ga0182005_100010737 190
96 3300025208 Ga0209436_101424 Ga0209436_1014247 190
97 3300025233 Ga0209437_100262 Ga0209437_10026218 190
98 3300025904 Ga0207647_10114973 Ga0207647_101149732 190
99 3300025912 Ga0207707_10053541 Ga0207707_100535413 190
100 3300025924 Ga0207694_10044494 Ga0207694_100444944 190
101 3300026089 Ga0207648_10593348 Ga0207648_105933482 190
102 3300028794 Ga0307515_10104762 Ga0307515_101047623 190
103 3300030731 Ga0316177_1078711 Ga0316177_107871115 190
104 3300030732 Ga0316176_1066110 Ga0316176_10661104 190
105 3300030742 Ga0316183_1117238 Ga0316183_11172385 190
106 3300030744 Ga0316181_1029685 Ga0316181_10296853 190
107 3300030744 Ga0316181_1214260 Ga0316181_12142605 190
108 3300030745 Ga0316182_1117588 Ga0316182_11175885 190
109 3300032004 Ga0307414_10002272 Ga0307414_100022726 190
110 3300032004 Ga0307414_10017234 Ga0307414_100172344 190
111 3300032004 Ga0307414_10041943 Ga0307414_100419434 190
112 3300048924 Ga0496121_0000043 Ga0496121_0000043_290558_291160 190
113 3300049758 Ga0501241_004112 Ga0501241_004112_729_1334 190
114 3300053125 Ga0500618_000073 Ga0500618_000073_6047_6670 190
115 iso_pu_bacteria 2738541283 2738757977 190
116 iso_pu_bacteria 2775506987 2776615941 190
117 iso_pu_bacteria 2818991442 2819576872 190
118 iso_pu_bacteria 2821136567 2821142955 190
119 iso_pu_bacteria 2904467357 2904470682 190
120 iso_pu_bacteria 2929177148 2929180631 190
121 iso_pu_bacteria 2945977869 2945983030 190
122 iso_pu_bacteria 2946013367 2946017575 190
123 3300002067 JGI24735J21928_10000084 JGI24735J21928_1000008419 191
124 3300003320 rootH2_10215592 rootH2_102155923 191
125 3300003322 rootL2_10140154 rootL2_101401547 191
126 3300005539 Ga0068853_100073967 Ga0068853_1000739672 191
127 3300006195 Ga0075366_10027376 Ga0075366_100273765 191
128 3300010375 Ga0105239_10089486 Ga0105239_100894863 191
129 3300013102 Ga0157371_10034044 Ga0157371_100340442 191
130 3300013105 Ga0157369_10096572 Ga0157369_100965724 191
131 3300013306 Ga0163162_10025955 Ga0163162_100259553 191
132 3300013307 Ga0157372_10011278 Ga0157372_100112788 191
133 3300046471 Ga0495650_0000095 Ga0495650_0000095_93906_94481 191
134 3300046492 Ga0495585_0000057 Ga0495585_0000057_93522_94097 191
135 3300046506 Ga0495583_0057173 Ga0495583_0057173_846_1421 191
136 3300046507 Ga0495606_0000009 Ga0495606_0000009_156169_156744 191
137 3300046512 Ga0495610_0005897 Ga0495610_0005897_2930_3505 191
138 3300046513 Ga0495616_0003284 Ga0495616_0003284_7496_8071 191
139 3300046538 Ga0495609_0015004 Ga0495609_0015004_2915_3490 191
140 3300046558 Ga0495633_0004626 Ga0495633_0004626_1877_2452 191
141 3300046660 Ga0495625_0000007 Ga0495625_0000007_176919_177494 191
142 3300046665 Ga0495661_0004315 Ga0495661_0004315_8998_9573 191
143 3300046694 Ga0495649_0000007 Ga0495649_0000007_257660_258235 191
144 3300047443 Ga0495687_007395 Ga0495687_007395_4646_5221 191
145 3300047472 Ga0495686_0031884 Ga0495686_0031884_2432_3007 191
146 3300050493 nmdc:mga0k408_23015_c1 nmdc:mga0k408_23015_c1_2015_2590 191
147 3300053125 Ga0500618_019342 Ga0500618_019342_749_1324 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

42

110

0.95

Feature Viewer

pLDDT pTM Quality
80.95 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map