F198517

General Info

Members Datasets Scaffolds Average Seq Length
146 110 139 179

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0000451|Ga0495625_0000451_6347_6964
Length 205
Sequence VQHALSHRNVLEEEMKTKTSRAALFAVLGAATLMTAGCATETAYRPATGTGFARAGYSDRMIEPNRFMVSFAGNTYTARDTVERYLLYRAAELTVQHGYDYFILSDRQTDRRSRTYTTPSAFGPGPYGYWGPSWRYRGRGFGWRSWDPFWGXXXXDRGVDINTVDKYEANAEIVLGRGPKPRDNVRAFDAREVMRNLGPSIVTPQ

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
3 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
4 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
5 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
6 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
7 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
94 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
99 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
102 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
103 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
104 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
105 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
106 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
107 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
108 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.84
Metatranscriptomes 1.37
Isolates 4.79

Biome Distribution

Category Percentage (%)
Aerial Root 2.05
Bulb 0
Endosphere 12.33
Nodule 0
Rhizoplane 2.05
Rhizosphere 76.03
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005309 3300001989 Bacteria 4907
2 JGI24737J22298_10005653 3300001990 Bacteria 4305
3 JGI24735J21928_10001441 3300002067 Bacteria 8410
4 JGI24738J21930_10000585 3300002075 Bacteria 10462
5 JGI25165J46597_1000053 3300003214 Bacteria 235857
6 rootH2_10134643 3300003320 Bacteria 1288
7 rootL2_10098888 3300003322 Bacteria 1879
8 Ga0058863_11658733 3300004799 Bacteria 625
9 Ga0058862_12369427 3300004803 Bacteria 812
10 Ga0065165_1002844 3300005262 Bacteria 13468
11 Ga0068869_100218946 3300005334 Bacteria 1508
12 Ga0070666_10536347 3300005335 Bacteria 850
13 Ga0070668_100003920 3300005347 Bacteria 10992
14 Ga0070659_100277069 3300005366 Bacteria 1395
15 Ga0070662_100160360 3300005457 Bacteria 1759
16 Ga0068853_100738584 3300005539 Bacteria 940
17 Ga0070672_100424672 3300005543 Bacteria 1142
18 Ga0068855_100544110 3300005563 Bacteria 1257
19 Ga0070664_100088806 3300005564 Bacteria 2673
20 Ga0068857_100126115 3300005577 Bacteria 2307
21 Ga0068854_100403287 3300005578 Bacteria 1132
22 Ga0068852_100521865 3300005616 Unclassified 1185
23 Ga0068859_100186441 3300005617 Bacteria 2158
24 Ga0068864_100003879 3300005618 Bacteria 12309
25 Ga0068864_100366346 3300005618 Bacteria 1363
26 Ga0068861_100243152 3300005719 Bacteria 1532
27 Ga0068858_100000423 3300005842 Bacteria 44051
28 Ga0068858_100001286 3300005842 Bacteria 25909
29 Ga0068860_100504638 3300005843 Unclassified 1208
30 Ga0068862_101001024 3300005844 Unclassified 827
31 Ga0075366_10081938 3300006195 Bacteria 1928
32 Ga0075370_10092241 3300006353 Bacteria 1748
33 Ga0068871_100915633 3300006358 Bacteria 813
34 Ga0097620_100186443 3300006931 Bacteria 2158
35 Ga0105240_10005853 3300009093 Bacteria 18229
36 Ga0105240_10020708 3300009093 Bacteria 8763
37 Ga0105245_10013601 3300009098 Bacteria 7089
38 Ga0105242_10217930 3300009176 Bacteria 1704
39 Ga0105248_10062278 3300009177 Bacteria 4189
40 Ga0105238_10053134 3300009551 Bacteria 4072
41 Ga0105238_10236844 3300009551 Bacteria 1803
42 Ga0105238_10441457 3300009551 Bacteria 1298
43 Ga0105238_11023492 3300009551 Bacteria 847
44 Ga0105246_10123529 3300011119 Bacteria 1922
45 Ga0157370_10601063 3300013104 Bacteria 1007
46 Ga0157369_10050793 3300013105 Bacteria 4488
47 Ga0157369_10140699 3300013105 Bacteria 2553
48 Ga0157374_10428193 3300013296 Bacteria 1323
49 Ga0157378_10039412 3300013297 Bacteria 4190
50 Ga0157378_10187032 3300013297 Bacteria 1951
51 Ga0163162_10226364 3300013306 Bacteria 2000
52 Ga0157372_10182892 3300013307 Unclassified 2427
53 Ga0157372_10909049 3300013307 Bacteria 1021
54 Ga0163161_10635520 3300017792 Bacteria 883
55 Ga0213876_10028634 3300021384 Bacteria 2937
56 Ga0209233_1000119 3300025261 Bacteria 235924
57 Ga0207680_10045727 3300025903 Bacteria 2583
58 Ga0207647_10000178 3300025904 Bacteria 50957
59 Ga0207654_10524556 3300025911 Bacteria 839
60 Ga0207695_10053974 3300025913 Bacteria 4200
61 Ga0207694_10066275 3300025924 Bacteria 2817
62 Ga0207694_10102045 3300025924 Bacteria 2274
63 Ga0207694_10572467 3300025924 Bacteria 949
64 Ga0207694_10926556 3300025924 Bacteria 737
65 Ga0207687_10016037 3300025927 Bacteria 4917
66 Ga0207690_10461754 3300025932 Bacteria 1022
67 Ga0207690_10478288 3300025932 Bacteria 1005
68 Ga0207690_10537456 3300025932 Bacteria 949
69 Ga0207706_10018005 3300025933 Bacteria 6356
70 Ga0207686_10215886 3300025934 Bacteria 1382
71 Ga0207711_10058920 3300025941 Bacteria 3306
72 Ga0207689_10291660 3300025942 Bacteria 1351
73 Ga0207668_10304823 3300025972 Bacteria 1316
74 Ga0207668_11327365 3300025972 Bacteria 648
75 Ga0207640_10044984 3300025981 Bacteria 2832
76 Ga0207640_10587822 3300025981 Bacteria 941
77 Ga0207703_10001155 3300026035 Bacteria 24910
78 Ga0207703_10001220 3300026035 Bacteria 24044
79 Ga0207639_10116622 3300026041 Bacteria 2187
80 Ga0207676_10002807 3300026095 Bacteria 12387
81 Ga0207676_10362808 3300026095 Bacteria 1343
82 Ga0268265_10234861 3300028380 Bacteria 1614
83 Ga0307517_10044963 3300028786 Bacteria 4653
84 Ga0265338_10009752 3300028800 Bacteria 11391
85 Ga0265338_10029873 3300028800 Bacteria 5392
86 Ga0265338_10158929 3300028800 Bacteria 1748
87 Ga0265338_10217681 3300028800 Bacteria 1429
88 Ga0265324_10103635 3300029957 Unclassified 966
89 Ga0265327_10000290 3300031251 Bacteria 98475
90 Ga0265327_10001958 3300031251 Bacteria 23590
91 Ga0265327_10012891 3300031251 Bacteria 5598
92 Ga0307513_10395887 3300031456 Bacteria 1117
93 Ga0307508_10000537 3300031616 Bacteria 45080
94 Ga0307412_10097718 3300031911 Bacteria 2069
95 Ga0307510_10004156 3300033180 Bacteria 16999
96 Ga0373937_0211348 3300036401 Bacteria 1826
97 Ga0373937_0273648 3300036401 Bacteria 1594
98 Ga0316582_0521276 3300036647 Bacteria 819
99 Ga0316584_0116789 3300036712 Unclassified 1995
100 Ga0395899_0139287 3300037312 Bacteria 1727
101 Ga0395900_0156335 3300037418 Bacteria 2329
102 Ga0395900_0368084 3300037418 Bacteria 1407
103 Ga0395898_0884969 3300037466 Bacteria 831
104 Ga0395901_0023000 3300038443 Bacteria 6389
105 Ga0395901_0204138 3300038443 Bacteria 2071
106 Ga0436365_0393398 3300039437 Bacteria 7401
107 Ga0436365_1430082 3300039437 Bacteria 1881
108 Ga0495585_0214074 3300046492 Bacteria 975
109 Ga0495583_0007448 3300046506 Bacteria 6872
110 Ga0495648_0097284 3300046524 Bacteria 1633
111 Ga0495668_0038705 3300046616 Bacteria 2664
112 Ga0495668_0084947 3300046616 Bacteria 1736
113 Ga0495625_0000451 3300046660 Bacteria 61644
114 Ga0495625_0005174 3300046660 Bacteria 12035
115 Ga0495625_0013067 3300046660 Bacteria 6691
116 Ga0495625_0235929 3300046660 Bacteria 1193
117 Ga0495670_0019355 3300046691 Bacteria 3354
118 Ga0495677_0033971 3300047445 Bacteria 1860
119 Ga0495686_0000191 3300047472 Bacteria 114738
120 Ga0495686_0063074 3300047472 Bacteria 2297
121 Ga0495686_0115111 3300047472 Bacteria 1608
122 Ga0496105_0307285 3300048908 Bacteria 1274
123 Ga0496115_0044992 3300048918 Bacteria 3523
124 Ga0501241_010726 3300049758 Bacteria 1664
125 Ga0501267_004501 3300049764 Bacteria 1298
126 Ga0501035_0298479 3300049822 Bacteria 1358
127 nmdc:mga0k408_100143_c1 3300050493 Bacteria 1708
128 nmdc:mga07m45_155470_c1 3300050496 Bacteria 1327
129 Ga0500643_001036 3300053087 Bacteria 16907
130 Ga0500643_015587 3300053087 Bacteria 2601
131 Ga0500641_0078923 3300053096 Bacteria 1395
132 Ga0500650_0107959 3300053098 Bacteria 1300
133 Ga0500642_0000002 3300053130 Bacteria 795093
134 Ga0500658_0006543 3300053134 Bacteria 4320
135 Ga0500559_0013489 3300053136 Bacteria 3461
136 Ga0500559_0056551 3300053136 Bacteria 1741
137 Ga0500616_0013392 3300053153 Bacteria 4763
138 Ga0500616_0080030 3300053153 Bacteria 1644
139 Ga0500645_004827 3300053730 Bacteria 5087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10158929 Ga0265338_101589293 140
2 3300053153 Ga0500616_0013392 Ga0500616_0013392_3649_4269 143
3 3300046660 Ga0495625_0235929 Ga0495625_0235929_349_966 144
4 3300005262 Ga0065165_1002844 Ga0065165_10028448 146
5 3300047472 Ga0495686_0063074 Ga0495686_0063074_87_704 150
6 3300053153 Ga0500616_0080030 Ga0500616_0080030_955_1572 150
7 3300009551 Ga0105238_11023492 Ga0105238_110234921 151
8 3300025924 Ga0207694_10926556 Ga0207694_109265561 151
9 3300038443 Ga0395901_0204138 Ga0395901_0204138_438_995 151
10 3300039437 Ga0436365_1430082 Ga0436365_1430082_1370_1870 151
11 3300025932 Ga0207690_10537456 Ga0207690_105374561 152
12 3300031251 Ga0265327_10001958 Ga0265327_1000195811 153
13 3300013105 Ga0157369_10050793 Ga0157369_100507936 154
14 3300003320 rootH2_10134643 rootH2_101346432 155
15 3300004799 Ga0058863_11658733 Ga0058863_116587331 155
16 3300047472 Ga0495686_0000191 Ga0495686_0000191_74399_74977 155
17 3300013307 Ga0157372_10909049 Ga0157372_109090492 156
18 3300028800 Ga0265338_10217681 Ga0265338_102176813 158
19 3300003214 JGI25165J46597_1000053 JGI25165J46597_100005384 159
20 3300025261 Ga0209233_1000119 Ga0209233_1000119149 159
21 3300037312 Ga0395899_0139287 Ga0395899_0139287_229_807 159
22 3300037418 Ga0395900_0156335 Ga0395900_0156335_369_947 159
23 3300037418 Ga0395900_0368084 Ga0395900_0368084_233_811 159
24 3300037466 Ga0395898_0884969 Ga0395898_0884969_21_599 159
25 3300046524 Ga0495648_0097284 Ga0495648_0097284_976_1524 159
26 3300005366 Ga0070659_100277069 Ga0070659_1002770692 160
27 3300025932 Ga0207690_10461754 Ga0207690_104617541 160
28 3300036647 Ga0316582_0521276 Ga0316582_0521276_260_772 160
29 3300036712 Ga0316584_0116789 Ga0316584_0116789_1247_1759 160
30 3300013297 Ga0157378_10187032 Ga0157378_101870322 161
31 3300005618 Ga0068864_100003879 Ga0068864_1000038798 162
32 3300005719 Ga0068861_100243152 Ga0068861_1002431524 162
33 3300005842 Ga0068858_100001286 Ga0068858_10000128627 162
34 3300009093 Ga0105240_10020708 Ga0105240_100207087 162
35 3300009177 Ga0105248_10062278 Ga0105248_100622782 162
36 3300013104 Ga0157370_10601063 Ga0157370_106010631 162
37 3300013105 Ga0157369_10140699 Ga0157369_101406992 162
38 3300013306 Ga0163162_10226364 Ga0163162_102263641 162
39 3300025941 Ga0207711_10058920 Ga0207711_100589202 162
40 3300026035 Ga0207703_10001155 Ga0207703_1000115526 162
41 3300026095 Ga0207676_10002807 Ga0207676_100028078 162
42 3300005543 Ga0070672_100424672 Ga0070672_1004246721 163
43 3300053134 Ga0500658_0006543 Ga0500658_0006543_2512_3129 163
44 3300028800 Ga0265338_10009752 Ga0265338_100097522 164
45 3300048918 Ga0496115_0044992 Ga0496115_0044992_1222_1821 164
46 3300031251 Ga0265327_10000290 Ga0265327_100002902 165
47 3300046506 Ga0495583_0007448 Ga0495583_0007448_5300_5866 165
48 3300046616 Ga0495668_0038705 Ga0495668_0038705_1079_1645 165
49 3300046660 Ga0495625_0005174 Ga0495625_0005174_2837_3403 165
50 3300047445 Ga0495677_0033971 Ga0495677_0033971_567_1133 165
51 3300053087 Ga0500643_001036 Ga0500643_001036_15203_15769 165
52 3300004803 Ga0058862_12369427 Ga0058862_123694271 166
53 3300005564 Ga0070664_100088806 Ga0070664_1000888062 166
54 3300005577 Ga0068857_100126115 Ga0068857_1001261152 166
55 3300025981 Ga0207640_10044984 Ga0207640_100449843 166
56 3300028800 Ga0265338_10029873 Ga0265338_100298733 166
57 3300036401 Ga0373937_0273648 Ga0373937_0273648_387_1016 166
58 3300005347 Ga0070668_100003920 Ga0070668_1000039207 167
59 3300005617 Ga0068859_100186441 Ga0068859_1001864411 167
60 3300005843 Ga0068860_100504638 Ga0068860_1005046381 167
61 3300005844 Ga0068862_101001024 Ga0068862_1010010242 167
62 3300006931 Ga0097620_100186443 Ga0097620_1001864431 167
63 3300025972 Ga0207668_10304823 Ga0207668_103048232 167
64 3300028380 Ga0268265_10234861 Ga0268265_102348612 167
65 3300029957 Ga0265324_10103635 Ga0265324_101036351 167
66 3300031251 Ga0265327_10012891 Ga0265327_100128914 167
67 3300048908 Ga0496105_0307285 Ga0496105_0307285_15_602 167
68 3300006195 Ga0075366_10081938 Ga0075366_100819382 168
69 3300006353 Ga0075370_10092241 Ga0075370_100922411 168
70 3300036401 Ga0373937_0211348 Ga0373937_0211348_150_731 168
71 3300046616 Ga0495668_0084947 Ga0495668_0084947_795_1346 168
72 3300046660 Ga0495625_0013067 Ga0495625_0013067_2963_3514 168
73 3300050493 nmdc:mga0k408_100143_c1 nmdc:mga0k408_100143_c1_496_1047 168
74 3300050496 nmdc:mga07m45_155470_c1 nmdc:mga07m45_155470_c1_30_581 168
75 3300053087 Ga0500643_015587 Ga0500643_015587_825_1376 168
76 3300053096 Ga0500641_0078923 Ga0500641_0078923_355_936 168
77 3300053098 Ga0500650_0107959 Ga0500650_0107959_78_653 168
78 3300053130 Ga0500642_0000002 Ga0500642_0000002_9958_10509 168
79 3300053730 Ga0500645_004827 Ga0500645_004827_2861_3412 168
80 3300005335 Ga0070666_10536347 Ga0070666_105363471 169
81 3300009093 Ga0105240_10005853 Ga0105240_1000585311 169
82 3300009551 Ga0105238_10236844 Ga0105238_102368442 169
83 3300025903 Ga0207680_10045727 Ga0207680_100457272 169
84 3300025911 Ga0207654_10524556 Ga0207654_105245561 169
85 3300025913 Ga0207695_10053974 Ga0207695_100539742 169
86 3300033180 Ga0307510_10004156 Ga0307510_1000415611 169
87 3300038443 Ga0395901_0023000 Ga0395901_0023000_4647_5219 169
88 iso_pu_bacteria 2751185897 2753763822 169
89 3300005334 Ga0068869_100218946 Ga0068869_1002189462 170
90 3300005578 Ga0068854_100403287 Ga0068854_1004032871 170
91 3300021384 Ga0213876_10028634 Ga0213876_100286343 170
92 3300025942 Ga0207689_10291660 Ga0207689_102916602 170
93 3300025981 Ga0207640_10587822 Ga0207640_105878221 170
94 3300026041 Ga0207639_10116622 Ga0207639_101166222 170
95 3300039437 Ga0436365_0393398 Ga0436365_0393398_5847_6434 170
96 3300046660 Ga0495625_0000451 Ga0495625_0000451_6347_6964 170
97 3300049822 Ga0501035_0298479 Ga0501035_0298479_729_1313 170
98 3300053136 Ga0500559_0013489 Ga0500559_0013489_1996_2580 170
99 iso_pu_bacteria 2928027323 2928030914 170
100 iso_pu_bacteria 2984555340 2984557886 170
101 iso_pu_bacteria 2984564862 2984567748 170
102 iso_pu_bacteria 2993356040 2993358800 170
103 3300005563 Ga0068855_100544110 Ga0068855_1005441102 171
104 3300005618 Ga0068864_100366346 Ga0068864_1003663462 171
105 3300005842 Ga0068858_100000423 Ga0068858_10000042316 171
106 3300006358 Ga0068871_100915633 Ga0068871_1009156331 171
107 3300009098 Ga0105245_10013601 Ga0105245_100136019 171
108 3300009176 Ga0105242_10217930 Ga0105242_102179302 171
109 3300009551 Ga0105238_10053134 Ga0105238_100531342 171
110 3300011119 Ga0105246_10123529 Ga0105246_101235292 171
111 3300013296 Ga0157374_10428193 Ga0157374_104281932 171
112 3300013297 Ga0157378_10039412 Ga0157378_100394124 171
113 3300017792 Ga0163161_10635520 Ga0163161_106355201 171
114 3300025924 Ga0207694_10102045 Ga0207694_101020452 171
115 3300025927 Ga0207687_10016037 Ga0207687_100160378 171
116 3300025934 Ga0207686_10215886 Ga0207686_102158862 171
117 3300025972 Ga0207668_11327365 Ga0207668_113273651 171
118 3300026035 Ga0207703_10001220 Ga0207703_1000122016 171
119 3300026095 Ga0207676_10362808 Ga0207676_103628082 171
120 3300028786 Ga0307517_10044963 Ga0307517_100449632 171
121 3300031456 Ga0307513_10395887 Ga0307513_103958872 171
122 3300031616 Ga0307508_10000537 Ga0307508_1000053727 171
123 3300031911 Ga0307412_10097718 Ga0307412_100977182 171
124 3300046492 Ga0495585_0214074 Ga0495585_0214074_78_674 171
125 3300046691 Ga0495670_0019355 Ga0495670_0019355_2065_2646 171
126 3300047472 Ga0495686_0115111 Ga0495686_0115111_497_1069 171
127 3300053136 Ga0500559_0056551 Ga0500559_0056551_462_1046 171
128 iso_pu_bacteria 2599185354 2600200366 171
129 iso_pu_bacteria 2885429604 2885429700 171
130 3300009551 Ga0105238_10441457 Ga0105238_104414571 172
131 3300025924 Ga0207694_10066275 Ga0207694_100662752 172
132 3300025924 Ga0207694_10572467 Ga0207694_105724672 172
133 3300049764 Ga0501267_004501 Ga0501267_004501_233_814 172
134 3300005539 Ga0068853_100738584 Ga0068853_1007385841 175
135 3300005616 Ga0068852_100521865 Ga0068852_1005218651 176
136 3300049758 Ga0501241_010726 Ga0501241_010726_342_926 176
137 3300001989 JGI24739J22299_10005309 JGI24739J22299_100053092 177
138 3300001990 JGI24737J22298_10005653 JGI24737J22298_100056532 177
139 3300002067 JGI24735J21928_10001441 JGI24735J21928_100014416 177
140 3300002075 JGI24738J21930_10000585 JGI24738J21930_100005857 177
141 3300003322 rootL2_10098888 rootL2_100988882 177
142 3300005457 Ga0070662_100160360 Ga0070662_1001603602 177
143 3300013307 Ga0157372_10182892 Ga0157372_101828922 177
144 3300025904 Ga0207647_10000178 Ga0207647_100001789 177
145 3300025932 Ga0207690_10478288 Ga0207690_104782881 177
146 3300025933 Ga0207706_10018005 Ga0207706_100180052 177

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xxb-assembly1.cif.gz_O large subunit of toxoplasma gondii ribosome 0.6485 73 150
3g4s-assembly1.cif.gz_R co-crystal structure of tiamulin bound to the large ribosomal subunit 0.6302 60 147
6th6-assembly1.cif.gz_BV cryo-em structure of t. kodakarensis 70s ribosome 0.6283 73 150
6cww-assembly1.cif.gz_A cs h-nox mutant with unnatural amino acid 4-cyano-l-phenylalanine at site 5 0.5861 38 148
4v6u-assembly1.cif.gz_BS promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.5835 73 152
ID Description Score Start End Superfamily
af_K7MZM3_401_688_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7985 43 60 2.130.10.10
af_I1M2G3_44_149_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6548 42 147 3.40.50.2000
3u5iP00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.612 73 152 3.90.470.10
3u6yC00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Alba-like domain 0.6063 52 149 3.30.110.20
af_A0A0R0G5W5_110_196_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6011 44 156 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A847REI0-F1-model_v4 deleted 0.8869 42 172
AF-A0A0P7YNW7-F1-model_v4 Uncharacterized protein 0.8689 43 172
AF-A0A5A9ZCE5-F1-model_v4 Uncharacterized protein 0.8516 43 176
AF-A0A239D399-F1-model_v4 Lipoprotein 0.8494 43 172
AF-A0A351PWS4-F1-model_v4 deleted 0.8378 27 172

Feature Viewer

pLDDT pTM Quality
72.48 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map