F198356

General Info

Members Datasets Scaffolds Average Seq Length
146 68 292 246

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0227695|Ga0466971_0227695_58_864
Length 268
Sequence MPSTVRRPGLQLQPPRLLVRRDGPLGGYESALGRAGFELVAGTDEAGRGACAGPLVVAACILPPGRRGRIDGLDDSKALTAAVRERLFAKVTARALAYAIVVIPAAEIDAWGLHVANVAGMRRAIGMLDPSPQYTLTDGFPVSGLAMPSTAVWKGDATVACIAAASILAKVTRDAIMTRMHEQWPQYEFAQHKGYVTSGHAAALTEWGPCPQHRRRYVNVRRALRSLPGGFGAVDPAADELLEDPGLEFMDDNGSGDQAASLTTMEIA

Samples

Sample ID Description Type Environment
1 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
5 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
11 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
12 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
13 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
14 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
17 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
19 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
29 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
30 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
31 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
32 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
33 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
34 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
35 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
36 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
37 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
38 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
39 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
40 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
41 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
42 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
43 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
44 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
45 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
46 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
47 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
48 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
49 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
50 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
51 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
52 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
53 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
54 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
55 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
56 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
57 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
58 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
66 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
68 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 1.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.22
Rhizosphere 85.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466971_0227695 3300044719 Bacteria 885
2 Ga0070658_10170227 3300005327 Bacteria 1830
3 Ga0070683_100042787 3300005329 Bacteria 4172
4 Ga0070683_100365007 3300005329 Bacteria 1375
5 Ga0070679_100271504 3300005530 Bacteria 1650
6 Ga0070665_100110779 3300005548 Bacteria 2747
7 Ga0070665_100147224 3300005548 Bacteria 2358
8 Ga0070665_100191633 3300005548 Bacteria 2045
9 Ga0068855_100018553 3300005563 Bacteria 8365
10 Ga0068855_100020818 3300005563 Bacteria 7864
11 Ga0068856_100038303 3300005614 Bacteria 4706
12 Ga0068856_100075275 3300005614 Bacteria 3344
13 Ga0068856_100087984 3300005614 Bacteria 3089
14 Ga0068856_100092218 3300005614 Bacteria 3014
15 Ga0068852_100012354 3300005616 Bacteria 6480
16 Ga0068859_100009704 3300005617 Bacteria 9719
17 Ga0097620_100009704 3300006931 Bacteria 9719
18 Ga0105245_10030898 3300009098 Bacteria 4737
19 Ga0105247_10012142 3300009101 Bacteria 5177
20 Ga0105237_10126715 3300009545 Bacteria 2548
21 Ga0105237_10507588 3300009545 Bacteria 1212
22 Ga0105238_10423100 3300009551 Bacteria 1327
23 Ga0105239_11087114 3300010375 Bacteria 920
24 Ga0157374_10555015 3300013296 Bacteria 1157
25 Ga0197907_11093313 3300020069 Bacteria 1712
26 Ga0213876_10117114 3300021384 Bacteria 1414
27 Ga0224712_10107368 3300022467 Bacteria 1193
28 Ga0207710_10006542 3300025900 Bacteria 4966
29 Ga0207647_10075949 3300025904 Bacteria 2021
30 Ga0207705_10132172 3300025909 Bacteria 1858
31 Ga0207671_10031332 3300025914 Bacteria 3962
32 Ga0207671_10259904 3300025914 Bacteria 1366
33 Ga0207661_10083197 3300025944 Bacteria 2648
34 Ga0207667_10008347 3300025949 Bacteria 12310
35 Ga0207667_10097121 3300025949 Bacteria 3041
36 Ga0207702_10223710 3300026078 Bacteria 1755
37 Ga0207698_10009530 3300026142 Bacteria 6197
38 Ga0436365_0347242 3300039437 Bacteria 2504
39 Ga0436365_0895356 3300039437 Bacteria 4232
40 Ga0466969_0022457 3300044656 Bacteria 3256
41 Ga0466969_0073553 3300044656 Bacteria 1640
42 Ga0466969_0125800 3300044656 Bacteria 1191
43 Ga0466972_0034446 3300044658 Bacteria 2481
44 Ga0466972_0191450 3300044658 Bacteria 959
45 Ga0466965_0034645 3300044683 Bacteria 2470
46 Ga0466966_0009522 3300044684 Bacteria 6434
47 Ga0466966_0015127 3300044684 Bacteria 5104
48 Ga0466966_0022625 3300044684 Bacteria 4123
49 Ga0466966_0049911 3300044684 Bacteria 2663
50 Ga0466966_0060493 3300044684 Bacteria 2391
51 Ga0466966_0330787 3300044684 Bacteria 915
52 Ga0466961_0012553 3300044693 Bacteria 5423
53 Ga0466961_0080679 3300044693 Bacteria 2059
54 Ga0466961_0098787 3300044693 Bacteria 1840
55 Ga0466961_0103897 3300044693 Bacteria 1789
56 Ga0466961_0185607 3300044693 Bacteria 1290
57 Ga0466961_0390484 3300044693 Bacteria 845
58 Ga0466963_0001362 3300044694 Bacteria 13067
59 Ga0466963_0004759 3300044694 Bacteria 7915
60 Ga0466963_0028931 3300044694 Bacteria 3562
61 Ga0466963_0032162 3300044694 Bacteria 3396
62 Ga0466963_0036801 3300044694 Bacteria 3193
63 Ga0466963_0083621 3300044694 Bacteria 2165
64 Ga0466963_0098352 3300044694 Bacteria 2000
65 Ga0466963_0123625 3300044694 Bacteria 1783
66 Ga0466963_0183003 3300044694 Bacteria 1463
67 Ga0466963_0202094 3300044694 Bacteria 1390
68 Ga0466963_0272384 3300044694 Bacteria 1189
69 Ga0466963_0380816 3300044694 Bacteria 994
70 Ga0466964_0009482 3300044706 Bacteria 3667
71 Ga0466964_0074499 3300044706 Bacteria 1443
72 Ga0466971_0006778 3300044719 Bacteria 4984
73 Ga0466971_0007312 3300044719 Bacteria 4807
74 Ga0466971_0011648 3300044719 Bacteria 3851
75 Ga0466971_0049237 3300044719 Bacteria 1896
76 Ga0466968_0009301 3300044735 Bacteria 3780
77 Ga0466970_0025462 3300044765 Bacteria 3098
78 Ga0466970_0046633 3300044765 Bacteria 2308
79 Ga0466970_0054840 3300044765 Bacteria 2129
80 Ga0466970_0079091 3300044765 Bacteria 1775
81 Ga0466957_0007234 3300044842 Bacteria 6274
82 Ga0466957_0030811 3300044842 Bacteria 3203
83 Ga0466957_0115324 3300044842 Bacteria 1708
84 Ga0466957_0172813 3300044842 Bacteria 1408
85 Ga0466960_0078947 3300044901 Bacteria 1654
86 Ga0466960_0142037 3300044901 Bacteria 1276
87 Ga0466959_0016094 3300045049 Bacteria 5459
88 Ga0466959_0030780 3300045049 Bacteria 3974
89 Ga0466958_0008256 3300045836 Bacteria 5765
90 Ga0466958_0012760 3300045836 Bacteria 4765
91 Ga0466958_0024654 3300045836 Bacteria 3539
92 Ga0466958_0036351 3300045836 Bacteria 2947
93 Ga0466958_0095191 3300045836 Bacteria 1846
94 Ga0466958_0391947 3300045836 Bacteria 896
95 Ga0466967_0012737 3300045976 Bacteria 6456
96 Ga0466967_0019226 3300045976 Bacteria 5487
97 Ga0466967_0040212 3300045976 Bacteria 4025
98 Ga0466967_0044355 3300045976 Bacteria 3857
99 Ga0466967_0059599 3300045976 Bacteria 3379
100 Ga0466967_0106842 3300045976 Bacteria 2566
101 Ga0466967_0114998 3300045976 Bacteria 2477
102 Ga0466967_0132021 3300045976 Bacteria 2319
103 Ga0466967_0139208 3300045976 Bacteria 2259
104 Ga0466967_0200125 3300045976 Bacteria 1891
105 Ga0466967_0271106 3300045976 Bacteria 1626
106 Ga0466967_0277652 3300045976 Bacteria 1607
107 Ga0466967_0279185 3300045976 Bacteria 1602
108 Ga0466967_0282842 3300045976 Bacteria 1592
109 Ga0466967_0496392 3300045976 Bacteria 1197
110 Ga0466967_0568508 3300045976 Bacteria 1117
111 Ga0466967_0630300 3300045976 Bacteria 1059
112 Ga0495646_0276653 3300046680 Bacteria 893
113 Ga0496101_0031334 3300048904 Bacteria 3737
114 Ga0496101_0245124 3300048904 Bacteria 1395
115 Ga0496101_0318163 3300048904 Bacteria 1221
116 Ga0496102_0000639 3300048905 Bacteria 35597
117 Ga0496102_0001496 3300048905 Bacteria 20647
118 Ga0496103_0001461 3300048906 Bacteria 15822
119 Ga0496104_0766105 3300048907 Bacteria 872
120 Ga0496108_0060576 3300048911 Bacteria 3185
121 Ga0496109_0014020 3300048912 Bacteria 6967
122 Ga0496111_0318302 3300048914 Bacteria 1152
123 Ga0496112_0191957 3300048915 Bacteria 2004
124 Ga0496113_0122673 3300048916 Bacteria 2033
125 Ga0496117_0021691 3300048920 Bacteria 5184
126 Ga0496118_0061425 3300048921 Bacteria 2783
127 Ga0496119_0000055 3300048922 Bacteria 180121
128 Ga0496119_0013360 3300048922 Bacteria 6554
129 Ga0496120_0044252 3300048923 Bacteria 2588
130 Ga0496121_0028732 3300048924 Bacteria 5169
131 Ga0501031_0002903 3300049568 Bacteria 10952
132 Ga0501032_0001715 3300049569 Bacteria 17328
133 Ga0501037_0361939 3300049573 Bacteria 999
134 Ga0501038_0001641 3300049574 Bacteria 20815
135 Ga0501043_0052863 3300049579 Bacteria 3190
136 Ga0501047_0006256 3300049581 Bacteria 11189
137 Ga0501048_0000032 3300049582 Bacteria 65543
138 Ga0501070_0009969 3300049586 Bacteria 8034
139 Ga0501035_0006273 3300049822 Bacteria 11181
140 Ga0501035_0080053 3300049822 Bacteria 2885
141 Ga0501035_0136552 3300049822 Bacteria 2135
142 Ga0501044_0011257 3300049823 Bacteria 9697
143 Ga0501044_0234029 3300049823 Bacteria 1783
144 Ga0466962_0010971 3300061719 Bacteria 4360
145 Ga0466962_0054714 3300061719 Bacteria 1907
146 Ga0466962_0119455 3300061719 Bacteria 1271
147 Ga0466971_0227695
148 Ga0070658_10170227
149 Ga0070683_100042787
150 Ga0070683_100365007
151 Ga0070679_100271504
152 Ga0070665_100110779
153 Ga0070665_100147224
154 Ga0070665_100191633
155 Ga0068855_100018553
156 Ga0068855_100020818
157 Ga0068856_100038303
158 Ga0068856_100075275
159 Ga0068856_100087984
160 Ga0068856_100092218
161 Ga0068852_100012354
162 Ga0068859_100009704
163 Ga0097620_100009704
164 Ga0105245_10030898
165 Ga0105247_10012142
166 Ga0105237_10126715
167 Ga0105237_10507588
168 Ga0105238_10423100
169 Ga0105239_11087114
170 Ga0157374_10555015
171 Ga0197907_11093313
172 Ga0213876_10117114
173 Ga0224712_10107368
174 Ga0207710_10006542
175 Ga0207647_10075949
176 Ga0207705_10132172
177 Ga0207671_10031332
178 Ga0207671_10259904
179 Ga0207661_10083197
180 Ga0207667_10008347
181 Ga0207667_10097121
182 Ga0207702_10223710
183 Ga0207698_10009530
184 Ga0436365_0347242
185 Ga0436365_0895356
186 Ga0466969_0022457
187 Ga0466969_0073553
188 Ga0466969_0125800
189 Ga0466972_0034446
190 Ga0466972_0191450
191 Ga0466965_0034645
192 Ga0466966_0009522
193 Ga0466966_0015127
194 Ga0466966_0022625
195 Ga0466966_0049911
196 Ga0466966_0060493
197 Ga0466966_0330787
198 Ga0466961_0012553
199 Ga0466961_0080679
200 Ga0466961_0098787
201 Ga0466961_0103897
202 Ga0466961_0185607
203 Ga0466961_0390484
204 Ga0466963_0001362
205 Ga0466963_0004759
206 Ga0466963_0028931
207 Ga0466963_0032162
208 Ga0466963_0036801
209 Ga0466963_0083621
210 Ga0466963_0098352
211 Ga0466963_0123625
212 Ga0466963_0183003
213 Ga0466963_0202094
214 Ga0466963_0272384
215 Ga0466963_0380816
216 Ga0466964_0009482
217 Ga0466964_0074499
218 Ga0466971_0006778
219 Ga0466971_0007312
220 Ga0466971_0011648
221 Ga0466971_0049237
222 Ga0466968_0009301
223 Ga0466970_0025462
224 Ga0466970_0046633
225 Ga0466970_0054840
226 Ga0466970_0079091
227 Ga0466957_0007234
228 Ga0466957_0030811
229 Ga0466957_0115324
230 Ga0466957_0172813
231 Ga0466960_0078947
232 Ga0466960_0142037
233 Ga0466959_0016094
234 Ga0466959_0030780
235 Ga0466958_0008256
236 Ga0466958_0012760
237 Ga0466958_0024654
238 Ga0466958_0036351
239 Ga0466958_0095191
240 Ga0466958_0391947
241 Ga0466967_0012737
242 Ga0466967_0019226
243 Ga0466967_0040212
244 Ga0466967_0044355
245 Ga0466967_0059599
246 Ga0466967_0106842
247 Ga0466967_0114998
248 Ga0466967_0132021
249 Ga0466967_0139208
250 Ga0466967_0200125
251 Ga0466967_0271106
252 Ga0466967_0277652
253 Ga0466967_0279185
254 Ga0466967_0282842
255 Ga0466967_0496392
256 Ga0466967_0568508
257 Ga0466967_0630300
258 Ga0495646_0276653
259 Ga0496101_0031334
260 Ga0496101_0245124
261 Ga0496101_0318163
262 Ga0496102_0000639
263 Ga0496102_0001496
264 Ga0496103_0001461
265 Ga0496104_0766105
266 Ga0496108_0060576
267 Ga0496109_0014020
268 Ga0496111_0318302
269 Ga0496112_0191957
270 Ga0496113_0122673
271 Ga0496117_0021691
272 Ga0496118_0061425
273 Ga0496119_0000055
274 Ga0496119_0013360
275 Ga0496120_0044252
276 Ga0496121_0028732
277 Ga0501031_0002903
278 Ga0501032_0001715
279 Ga0501037_0361939
280 Ga0501038_0001641
281 Ga0501043_0052863
282 Ga0501047_0006256
283 Ga0501048_0000032
284 Ga0501070_0009969
285 Ga0501035_0006273
286 Ga0501035_0080053
287 Ga0501035_0136552
288 Ga0501044_0011257
289 Ga0501044_0234029
290 Ga0466962_0010971
291 Ga0466962_0054714
292 Ga0466962_0119455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01351

RNase_HII

Ribonuclease HII

41

220

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uwe-assembly1.cif.gz_C cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex 0.9521 35 222
7uwe-assembly1.cif.gz_C cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex 0.9327 35 222
3o3h-assembly1.cif.gz_A t. maritima rnase h2 d107n in complex with nucleic acid substrate and manganese ions 0.9232 28 213
3o3g-assembly1.cif.gz_A t. maritima rnase h2 in complex with nucleic acid substrate and calcium ions 0.9204 28 222
7uwh-assembly1.cif.gz_C cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex bound to ribonucleotide substrate 0.9191 37 227
ID Description Score Start End Superfamily
af_P10442_2_197_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9346 35 227 3.30.420.10
af_P9WH01_18_234_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9219 22 233 3.30.420.10
af_Q2FZ38_49_255_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9165 23 220 3.30.420.10
af_P10442_2_197_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9027 35 227 3.30.420.10
af_P9WH01_18_234_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8972 22 233 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A0F9MTS6-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9756 24 134 GO:0003723
GO:0004523
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A7V0V764-F1-model_v4 Ribonuclease HII (RNase HII) (EC 3.1.26.4) 0.9713 24 213 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0030145
GO:0032299
GO:0043137
AF-B8I7T9-F1-model_v4 Ribonuclease HII (RNase HII) (EC 3.1.26.4) 0.9675 24 214 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0030145
GO:0032299
GO:0043137
AF-A0A7W0P4B1-F1-model_v4 Ribonuclease HII (RNase HII) (EC 3.1.26.4) 0.9641 24 213 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0030145
GO:0032299
GO:0043137
AF-A0A7X9G032-F1-model_v4 Ribonuclease HII (RNase HII) (EC 3.1.26.4) 0.9634 27 213 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0030145
GO:0032299
GO:0043137

Map