F198310

General Info

Members Datasets Scaffolds Average Seq Length
146 106 120 225

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0000400|Ga0466972_0000400_17444_18163
Length 239
Sequence MFLFCILNEETMIQQQHSINWITFLLAWVAGFCDTATFVAGDSIFSAHVTGNFIVFAAQVTSDSNPVASWLKLLTFPVFIGAVMVGGLIAEKSQRKYKILYTEGMILMFCGLAAILLPMIKGFDENIIVYIVVMTTVVGMGLQNAFGKLFAKETLGPTTMMTGNVTQASLDWGNLIRKGKKADGQSWISFKKQLITIGGFLAGCIIGAVLSKWLGLGAIIIPGVAIVICYLVGESAQLN

Samples

Sample ID Description Type Environment
1 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
2 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2739367656 Pedobacter sp. CF523 Isolate Unclassified
6 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
7 2818991437 Pedobacter terrae 518 Isolate Unclassified
8 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
9 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
10 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
11 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
12 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
13 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
14 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
15 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
16 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
17 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
18 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
19 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
20 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
21 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
22 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
23 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
24 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
25 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
26 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
72 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
73 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
101 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
102 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
103 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
104 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
105 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
106 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.19
Metatranscriptomes 0
Isolates 17.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0.68
Rhizoplane 0
Rhizosphere 71.92
Stem 0
Stem Tuber 0
Unclassified 21.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10016127 3300003316 Bacteria 11418
2 rootH1_10165872 3300003316 Bacteria 2832
3 rootH1_10189442 3300003316 Bacteria 1359
4 rootH2_10034245 3300003320 Bacteria 9748
5 rootH2_10098603 3300003320 Bacteria 4197
6 rootH2_10246219 3300003320 Bacteria 1891
7 rootL2_10060643 3300003322 Bacteria 7724
8 rootL2_10146190 3300003322 Bacteria 2852
9 rootH1_10100241 3300003323 Bacteria 6339
10 rootH1_10111040 3300003323 Bacteria 9739
11 rootH1_10125743 3300003323 Unclassified 4440
12 Ga0065714_10002188 3300005288 Bacteria 166479
13 Ga0065714_10079453 3300005288 Bacteria 2515
14 Ga0065704_10071740 3300005289 Bacteria 10048
15 Ga0065715_10097413 3300005293 Bacteria 3709
16 Ga0065715_10097633 3300005293 Bacteria 3674
17 Ga0068857_100351738 3300005577 Bacteria 1364
18 Ga0079104_1000005 3300006946 Bacteria 407099
19 Ga0105244_10000007 3300009036 Bacteria 352275
20 Ga0105240_10000008 3300009093 Bacteria 618862
21 Ga0105240_10203014 3300009093 Bacteria 2322
22 Ga0105237_10001667 3300009545 Bacteria 28757
23 Ga0105239_10183141 3300010375 Bacteria 2344
24 Ga0157373_10000002 3300013100 Bacteria 750094
25 Ga0157371_10000085 3300013102 Bacteria 148566
26 Ga0157371_10404783 3300013102 Bacteria 999
27 Ga0157370_10000061 3300013104 Bacteria 115933
28 Ga0157370_10000358 3300013104 Bacteria 57816
29 Ga0157370_10049084 3300013104 Bacteria 4042
30 Ga0157369_10000004 3300013105 Bacteria 479764
31 Ga0163162_10002896 3300013306 Bacteria 16339
32 Ga0157372_10495679 3300013307 Bacteria 1424
33 Ga0163163_10104517 3300014325 Bacteria 2858
34 Ga0182008_10000273 3300014497 Bacteria 40454
35 Ga0182006_1000011 3300015261 Bacteria 408647
36 Ga0182006_1000441 3300015261 Bacteria 32970
37 Ga0182006_1001471 3300015261 Bacteria 14177
38 Ga0182007_10000006 3300015262 Bacteria 427355
39 Ga0163161_10001241 3300017792 Bacteria 19105
40 Ga0163161_10001718 3300017792 Bacteria 16045
41 Ga0163161_10001877 3300017792 Bacteria 15336
42 Ga0163161_10014762 3300017792 Bacteria 5441
43 Ga0209436_100697 3300025208 Bacteria 14138
44 Ga0209130_1001821 3300025284 Bacteria 12351
45 Ga0207426_1000114 3300025302 Bacteria 228273
46 Ga0207655_1000066 3300025728 Bacteria 246358
47 Ga0207695_10000021 3300025913 Bacteria 679399
48 Ga0207695_10086355 3300025913 Bacteria 3164
49 Ga0207671_10008670 3300025914 Bacteria 8584
50 Ga0207674_10426037 3300026116 Bacteria 1282
51 Ga0265327_10000010 3300031251 Bacteria 566817
52 Ga0307405_10000018 3300031731 Bacteria 182495
53 Ga0307405_10000027 3300031731 Bacteria 118118
54 Ga0307413_10000005 3300031824 Bacteria 67023
55 Ga0307407_10000104 3300031903 Bacteria 28193
56 Ga0307412_10000196 3300031911 Bacteria 41764
57 Ga0307416_100000052 3300032002 Bacteria 114516
58 Ga0307416_100000060 3300032002 Bacteria 102377
59 Ga0307414_10003847 3300032004 Bacteria 8075
60 Ga0307414_10054727 3300032004 Bacteria 2790
61 Ga0307414_10326313 3300032004 Bacteria 1308
62 Ga0307414_10394741 3300032004 Bacteria 1200
63 Ga0307414_10455058 3300032004 Bacteria 1123
64 Ga0307411_10000001 3300032005 Bacteria 931810
65 Ga0307510_10004785 3300033180 Bacteria 16016
66 Ga0395899_0292863 3300037312 Bacteria 1104
67 Ga0395900_0146745 3300037418 Bacteria 2412
68 Ga0395905_0004573 3300037471 Bacteria 14315
69 Ga0436361_0649758 3300039447 Bacteria 4836
70 Ga0439439_0094588 3300041406 Unclassified 819
71 Ga0439447_017809 3300041407 Bacteria 1929
72 Ga0439433_0012388 3300041999 Bacteria 1869
73 Ga0466972_0000400 3300044658 Bacteria 22988
74 Ga0495627_000003 3300046453 Bacteria 704557
75 Ga0495638_0047517 3300046460 Bacteria 2690
76 Ga0495650_0000023 3300046471 Bacteria 527763
77 Ga0495583_0053543 3300046506 Bacteria 1831
78 Ga0495606_0000060 3300046507 Bacteria 185907
79 Ga0495606_0009459 3300046507 Bacteria 8247
80 Ga0495606_0026436 3300046507 Bacteria 4138
81 Ga0495610_0000001 3300046512 Bacteria 1620061
82 Ga0495610_0000263 3300046512 Bacteria 54974
83 Ga0495610_0001375 3300046512 Bacteria 21610
84 Ga0495616_0000540 3300046513 Bacteria 28554
85 Ga0495637_0064852 3300046520 Bacteria 1489
86 Ga0495648_0007622 3300046524 Bacteria 8637
87 Ga0495652_0102823 3300046529 Bacteria 2314
88 Ga0495652_0250817 3300046529 Bacteria 1312
89 Ga0495654_0000001 3300046530 Bacteria 1513197
90 Ga0495622_0103287 3300046557 Bacteria 1305
91 Ga0495633_0000002 3300046558 Bacteria 488754
92 Ga0495633_0030932 3300046558 Bacteria 2599
93 Ga0495668_0000134 3300046616 Bacteria 112135
94 Ga0495668_0003857 3300046616 Bacteria 10962
95 Ga0495611_0000367 3300046648 Bacteria 29199
96 Ga0495625_0000018 3300046660 Bacteria 299567
97 Ga0495625_0013278 3300046660 Bacteria 6626
98 Ga0495661_0004755 3300046665 Bacteria 9744
99 Ga0495661_0026342 3300046665 Bacteria 3746
100 Ga0495661_0031413 3300046665 Bacteria 3371
101 Ga0495649_0000111 3300046694 Bacteria 71877
102 Ga0495649_0172627 3300046694 Bacteria 1130
103 Ga0495660_0159656 3300046810 Bacteria 1106
104 Ga0495687_000220 3300047443 Bacteria 80993
105 Ga0495686_0000812 3300047472 Bacteria 40457
106 Ga0495686_0001573 3300047472 Bacteria 24190
107 Ga0495686_0007997 3300047472 Bacteria 7842
108 Ga0495686_0023342 3300047472 Bacteria 4081
109 Ga0495686_0182323 3300047472 Unclassified 1216
110 Ga0496121_0014931 3300048924 Bacteria 8183
111 Ga0496122_0001694 3300048925 Bacteria 34182
112 Ga0496123_0006516 3300048926 Bacteria 11285
113 Ga0496124_0324428 3300048927 Bacteria 1101
114 Ga0501249_047821 3300049679 Bacteria 978
115 Ga0501266_000005 3300049763 Bacteria 346750
116 Ga0500641_0000017 3300053096 Bacteria 132678
117 Ga0500618_019684 3300053125 Bacteria 1659
118 Ga0500658_0000024 3300053134 Bacteria 117952
119 Ga0500573_0160154 3300053140 Bacteria 1226
120 Ga0500584_027809 3300053726 Bacteria 2629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0172627 Ga0495649_0172627_68_733 198
2 3300041406 Ga0439439_0094588 Ga0439439_0094588_28_681 210
3 3300046453 Ga0495627_000003 Ga0495627_000003_39633_40298 211
4 3300046530 Ga0495654_0000001 Ga0495654_0000001_1084165_1084830 211
5 3300047472 Ga0495686_0007997 Ga0495686_0007997_6059_6724 211
6 3300009093 Ga0105240_10000008 Ga0105240_10000008304 212
7 3300025913 Ga0207695_10000021 Ga0207695_1000002196 212
8 3300046648 Ga0495611_0000367 Ga0495611_0000367_13010_13681 214
9 3300014325 Ga0163163_10104517 Ga0163163_101045173 216
10 3300033180 Ga0307510_10004785 Ga0307510_100047858 216
11 iso_pu_bacteria 2585428115 2587943227 216
12 iso_pu_bacteria 2643221725 2644684940 216
13 iso_pu_bacteria 2802428842 2802653863 216
14 iso_pu_bacteria 2842083920 2842087985 216
15 iso_pu_bacteria 2977268062 2977270033 216
16 3300047472 Ga0495686_0000812 Ga0495686_0000812_27512_28198 217
17 iso_pu_bacteria 2881359912 2881361938 217
18 iso_pu_bacteria 2977232053 2977233289 217
19 3300031251 Ga0265327_10000010 Ga0265327_10000010131 218
20 3300046520 Ga0495637_0064852 Ga0495637_0064852_585_1259 218
21 iso_pu_bacteria 2818991460 2819681474 218
22 3300005293 Ga0065715_10097413 Ga0065715_100974134 219
23 3300017792 Ga0163161_10001241 Ga0163161_100012413 219
24 3300037312 Ga0395899_0292863 Ga0395899_0292863_101_766 219
25 3300037418 Ga0395900_0146745 Ga0395900_0146745_1412_2077 219
26 3300037471 Ga0395905_0004573 Ga0395905_0004573_4099_4764 219
27 3300047472 Ga0495686_0023342 Ga0495686_0023342_2247_2927 219
28 3300003316 rootH1_10165872 rootH1_101658722 220
29 3300005289 Ga0065704_10071740 Ga0065704_100717406 220
30 3300005293 Ga0065715_10097633 Ga0065715_100976333 220
31 3300006946 Ga0079104_1000005 Ga0079104_1000005261 220
32 3300009036 Ga0105244_10000007 Ga0105244_10000007149 220
33 3300013100 Ga0157373_10000002 Ga0157373_10000002358 220
34 3300013104 Ga0157370_10000061 Ga0157370_1000006135 220
35 3300015261 Ga0182006_1000011 Ga0182006_100001111 220
36 3300015261 Ga0182006_1000441 Ga0182006_10004414 220
37 3300025728 Ga0207655_1000066 Ga0207655_1000066119 220
38 3300031911 Ga0307412_10000196 Ga0307412_1000019649 220
39 3300032002 Ga0307416_100000052 Ga0307416_10000005266 220
40 3300039447 Ga0436361_0649758 Ga0436361_0649758_2393_3067 220
41 3300046512 Ga0495610_0000001 Ga0495610_0000001_1148841_1149506 220
42 3300046558 Ga0495633_0000002 Ga0495633_0000002_90596_91261 220
43 3300048924 Ga0496121_0014931 Ga0496121_0014931_3524_4189 220
44 3300048927 Ga0496124_0324428 Ga0496124_0324428_15_680 220
45 3300053096 Ga0500641_0000017 Ga0500641_0000017_2504_3169 220
46 3300053140 Ga0500573_0160154 Ga0500573_0160154_281_946 220
47 3300053726 Ga0500584_027809 Ga0500584_027809_366_1031 220
48 iso_pu_bacteria 2738541283 2738758826 220
49 iso_pu_bacteria 2945924605 2945927320 220
50 iso_pu_bacteria 2945997725 2946001407 220
51 iso_pu_bacteria 2993480792 2993484418 221
52 iso_pu_bacteria 2857618242 2857622946 222
53 iso_pu_bacteria 2884791551 2884795300 222
54 iso_pu_bacteria 2919437846 2919441596 222
55 iso_pu_bacteria 2929150217 2929153226 222
56 3300017792 Ga0163161_10014762 Ga0163161_100147623 223
57 3300044658 Ga0466972_0000400 Ga0466972_0000400_17444_18163 223
58 iso_pu_bacteria 2738541302 2738853077 223
59 iso_pu_bacteria 2739367656 2739618087 223
60 iso_pu_bacteria 2818991437 2819548724 223
61 iso_pu_bacteria 2842722452 2842725791 223
62 iso_pu_bacteria 2842909656 2842913005 223
63 iso_pu_bacteria 2857627736 2857630862 223
64 iso_pu_bacteria 2929177148 2929181620 223
65 iso_pu_bacteria 2945977869 2945984036 223
66 iso_pu_bacteria 2946013367 2946016572 223
67 iso_pu_bacteria 2954016120 2954017976 223
68 3300009545 Ga0105237_10001667 Ga0105237_1000166713 224
69 3300013104 Ga0157370_10000358 Ga0157370_1000035814 224
70 3300013306 Ga0163162_10002896 Ga0163162_1000289611 224
71 3300014497 Ga0182008_10000273 Ga0182008_1000027318 224
72 3300015261 Ga0182006_1001471 Ga0182006_10014712 224
73 3300025914 Ga0207671_10008670 Ga0207671_100086707 224
74 3300032004 Ga0307414_10326313 Ga0307414_103263131 224
75 3300046529 Ga0495652_0102823 Ga0495652_0102823_996_1670 224
76 3300046557 Ga0495622_0103287 Ga0495622_0103287_580_1254 224
77 3300048925 Ga0496122_0001694 Ga0496122_0001694_29862_30545 224
78 3300048926 Ga0496123_0006516 Ga0496123_0006516_1927_2610 224
79 3300003323 rootH1_10125743 rootH1_101257433 225
80 3300009093 Ga0105240_10203014 Ga0105240_102030142 225
81 3300010375 Ga0105239_10183141 Ga0105239_101831413 225
82 3300025913 Ga0207695_10086355 Ga0207695_100863551 225
83 3300032004 Ga0307414_10054727 Ga0307414_100547273 225
84 3300046507 Ga0495606_0026436 Ga0495606_0026436_1728_2408 225
85 3300046524 Ga0495648_0007622 Ga0495648_0007622_2383_3063 225
86 3300046529 Ga0495652_0250817 Ga0495652_0250817_361_1041 225
87 3300046616 Ga0495668_0000134 Ga0495668_0000134_80666_81346 225
88 3300046616 Ga0495668_0003857 Ga0495668_0003857_2462_3154 225
89 3300047472 Ga0495686_0001573 Ga0495686_0001573_11368_12048 225
90 3300047472 Ga0495686_0182323 Ga0495686_0182323_102_782 225
91 3300003316 rootH1_10016127 rootH1_100161278 226
92 3300003316 rootH1_10189442 rootH1_101894422 226
93 3300003320 rootH2_10034245 rootH2_100342452 226
94 3300003320 rootH2_10098603 rootH2_100986035 226
95 3300003320 rootH2_10246219 rootH2_102462192 226
96 3300003322 rootL2_10060643 rootL2_100606435 226
97 3300003322 rootL2_10146190 rootL2_101461902 226
98 3300003323 rootH1_10100241 rootH1_101002416 226
99 3300003323 rootH1_10111040 rootH1_101110402 226
100 3300005288 Ga0065714_10002188 Ga0065714_1000218825 226
101 3300005288 Ga0065714_10079453 Ga0065714_100794532 226
102 3300005577 Ga0068857_100351738 Ga0068857_1003517382 226
103 3300013102 Ga0157371_10000085 Ga0157371_1000008597 226
104 3300013102 Ga0157371_10404783 Ga0157371_104047832 226
105 3300013104 Ga0157370_10049084 Ga0157370_100490842 226
106 3300013105 Ga0157369_10000004 Ga0157369_10000004297 226
107 3300013307 Ga0157372_10495679 Ga0157372_104956792 226
108 3300015262 Ga0182007_10000006 Ga0182007_1000000688 226
109 3300017792 Ga0163161_10001718 Ga0163161_100017188 226
110 3300017792 Ga0163161_10001877 Ga0163161_100018776 226
111 3300025208 Ga0209436_100697 Ga0209436_1006972 226
112 3300025284 Ga0209130_1001821 Ga0209130_10018216 226
113 3300025302 Ga0207426_1000114 Ga0207426_100011423 226
114 3300026116 Ga0207674_10426037 Ga0207674_104260371 226
115 3300031731 Ga0307405_10000018 Ga0307405_100000186 226
116 3300031731 Ga0307405_10000027 Ga0307405_100000276 226
117 3300031824 Ga0307413_10000005 Ga0307413_1000000529 226
118 3300031903 Ga0307407_10000104 Ga0307407_1000010421 226
119 3300032002 Ga0307416_100000060 Ga0307416_1000000608 226
120 3300032004 Ga0307414_10003847 Ga0307414_100038478 226
121 3300032004 Ga0307414_10394741 Ga0307414_103947412 226
122 3300032004 Ga0307414_10455058 Ga0307414_104550582 226
123 3300032005 Ga0307411_10000001 Ga0307411_10000001814 226
124 3300041407 Ga0439447_017809 Ga0439447_017809_996_1679 226
125 3300041999 Ga0439433_0012388 Ga0439433_0012388_609_1313 226
126 3300046460 Ga0495638_0047517 Ga0495638_0047517_457_1137 226
127 3300046471 Ga0495650_0000023 Ga0495650_0000023_510003_510683 226
128 3300046506 Ga0495583_0053543 Ga0495583_0053543_255_935 226
129 3300046507 Ga0495606_0000060 Ga0495606_0000060_148823_149503 226
130 3300046507 Ga0495606_0009459 Ga0495606_0009459_4003_4683 226
131 3300046512 Ga0495610_0000263 Ga0495610_0000263_17014_17703 226
132 3300046512 Ga0495610_0001375 Ga0495610_0001375_11062_11742 226
133 3300046513 Ga0495616_0000540 Ga0495616_0000540_381_1061 226
134 3300046558 Ga0495633_0030932 Ga0495633_0030932_1180_1860 226
135 3300046660 Ga0495625_0000018 Ga0495625_0000018_33788_34468 226
136 3300046660 Ga0495625_0013278 Ga0495625_0013278_5732_6412 226
137 3300046665 Ga0495661_0004755 Ga0495661_0004755_2273_2953 226
138 3300046665 Ga0495661_0026342 Ga0495661_0026342_2869_3561 226
139 3300046665 Ga0495661_0031413 Ga0495661_0031413_2196_2876 226
140 3300046694 Ga0495649_0000111 Ga0495649_0000111_37287_37967 226
141 3300046810 Ga0495660_0159656 Ga0495660_0159656_325_1005 226
142 3300047443 Ga0495687_000220 Ga0495687_000220_24617_25297 226
143 3300049679 Ga0501249_047821 Ga0501249_047821_122_805 226
144 3300049763 Ga0501266_000005 Ga0501266_000005_166404_167087 226
145 3300053125 Ga0500618_019684 Ga0500618_019684_407_1102 226
146 3300053134 Ga0500658_0000024 Ga0500658_0000024_12212_12895 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06912

DUF1275

Protein of unknown function (DUF1275)

22

232

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sc3-assembly1.cif.gz_A human oct1 bound to fenoterol in inward-open conformation 0.609 5 215
4oaa-assembly1.cif.gz_B crystal structure of e. coli lactose permease g46w,g262w bound to sugar 0.6037 6 215
8sdz-assembly1.cif.gz_A structure of rat organic anion transporter 1 (oat1) in complex with probenecid 0.5945 10 218
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.5892 1 220
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.5847 8 215
ID Description Score Start End Superfamily
af_F1QN13_131_525_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.681 1 215 1.20.1250.20
af_I1M3G2_109_523_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6763 8 215 1.20.1250.20
af_A0A1D6PQ92_1_255_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6691 1 215 1.20.1250.20
af_A0A1D6FKK2_52_340_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6688 2 215 1.20.1250.20
af_O96186_278_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6627 8 216 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7L8UI92-F1-model_v4 DUF1275 domain-containing protein 0.9611 1 216 GO:0016020
AF-A0A4Z0EJE1-F1-model_v4 DUF1275 domain-containing protein 0.9559 2 225
AF-A0A7G5E3V1-F1-model_v4 DUF1275 domain-containing protein 0.9477 2 221 GO:0016020
AF-A0A3G6TUI6-F1-model_v4 deleted 0.9431 3 220
AF-I2GLS4-F1-model_v4 DUF1275 domain-containing protein 0.943 6 213 GO:0016020

Feature Viewer

pLDDT pTM Quality
82.22 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map