F197718

General Info

Members Datasets Scaffolds Average Seq Length
146 121 292 321

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10235951|Ga0207693_102359512
Length 352
Sequence VSPFIIALVAVSAVLHVSWNVRLKTAGDPVRAATVGLLAALAVIVPLGVVVQGFFLGMVANLFPFAPGGGTDVYGRMLAEELHDKLKQTVVVENRPGASMQIGTTAVAKSAPDGSMLLMASATSLAVNPNIYKSLAYDPIKDLAPIGLVGSAYFVLVANPALGVKTLPELIAYIKARPGQLSYASAGIGTPHHIFMELFMTMAGLKMQHVPYKGSVPALNDVLAGHIELMFCDVPPSAGMIQTGKVRALGVTTKARLAAFPDIPPINESVPGFEVAGWFMVVAPAKTPPAVVAKLHTEMKNVLDTPAIKEQIAKLSLLPVTSPSVDDMKAFVKSEIVRWGKVVEAAGIAGTE

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
61 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
62 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
63 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
73 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
74 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
75 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
118 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
119 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
120 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
121 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 0.68
Isolates 1.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.38
Nodule 0
Rhizoplane 12.33
Rhizosphere 63.7
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10235951 3300025915 Bacteria 1436
2 JGI25151J46595_10004115 3300003187 Bacteria 7782
3 Ga0055536_1000205 3300003781 Bacteria 48371
4 Ga0055530_10004514 3300003791 Bacteria 7126
5 Ga0055540_1000588 3300003792 Bacteria 26398
6 Ga0055540_1001355 3300003792 Bacteria 14701
7 Ga0055531_10000414 3300003794 Bacteria 40780
8 Ga0070676_10040572 3300005328 Bacteria 2696
9 Ga0070670_100031231 3300005331 Bacteria 4586
10 Ga0068868_100228380 3300005338 Bacteria 1561
11 Ga0070673_100549475 3300005364 Bacteria 1049
12 Ga0070714_100115108 3300005435 Bacteria 2386
13 Ga0070713_100232911 3300005436 Bacteria 1675
14 Ga0070710_10122170 3300005437 Bacteria 1577
15 Ga0070708_100027013 3300005445 Bacteria 4921
16 Ga0070681_10013231 3300005458 Bacteria 8198
17 Ga0070707_100007427 3300005468 Bacteria 10176
18 Ga0070679_100132073 3300005530 Unclassified 2477
19 Ga0068855_100356579 3300005563 Bacteria 1610
20 Ga0068864_100084170 3300005618 Bacteria 2794
21 Ga0081539_10005945 3300005985 Bacteria 12041
22 Ga0070717_10031634 3300006028 Bacteria 4258
23 Ga0075364_10010564 3300006051 Bacteria 5583
24 Ga0075364_10128130 3300006051 Bacteria 1702
25 Ga0075364_10151488 3300006051 Bacteria 1563
26 Ga0075428_100007499 3300006844 Bacteria 12090
27 Ga0075436_100182919 3300006914 Bacteria 1482
28 Ga0099794_10012562 3300007265 Bacteria 3659
29 Ga0111539_10176142 3300009094 Bacteria 2498
30 Ga0114129_10386164 3300009147 Bacteria 1848
31 Ga0105243_10102290 3300009148 Bacteria 2380
32 Ga0105248_10199268 3300009177 Bacteria 2255
33 Ga0105249_10246050 3300009553 Bacteria 1770
34 Ga0105246_10206981 3300011119 Bacteria 1529
35 Ga0157378_10484364 3300013297 Unclassified 1233
36 Ga0163162_10622236 3300013306 Bacteria 1205
37 Ga0157375_10045885 3300013308 Bacteria 4255
38 Ga0163163_10091065 3300014325 Bacteria 3063
39 Ga0157380_10329300 3300014326 Bacteria 1420
40 Ga0182008_10000254 3300014497 Bacteria 41536
41 Ga0182008_10020992 3300014497 Bacteria 3358
42 Ga0213875_10000009 3300021388 Bacteria 451129
43 Ga0209676_1000071 3300025292 Bacteria 309464
44 Ga0209676_1000706 3300025292 Bacteria 46545
45 Ga0209025_1000786 3300025294 Bacteria 52157
46 Ga0209050_1000868 3300025298 Bacteria 40876
47 Ga0209051_1000150 3300025303 Bacteria 132005
48 Ga0209051_1000169 3300025303 Bacteria 119220
49 Ga0209257_1000862 3300025304 Bacteria 43136
50 Ga0209257_1006280 3300025304 Bacteria 7763
51 Ga0207697_10127597 3300025315 Bacteria 1098
52 Ga0207707_10026512 3300025912 Bacteria 5065
53 Ga0207652_10138267 3300025921 Unclassified 2176
54 Ga0207646_10009700 3300025922 Bacteria 9491
55 Ga0207681_10083702 3300025923 Bacteria 2259
56 Ga0207650_10063383 3300025925 Bacteria 2763
57 Ga0207687_10158448 3300025927 Bacteria 1734
58 Ga0207664_10020863 3300025929 Bacteria 4862
59 Ga0207664_10374800 3300025929 Bacteria 1263
60 Ga0207665_10172306 3300025939 Bacteria 1563
61 Ga0207691_10196759 3300025940 Bacteria 1756
62 Ga0207711_10100099 3300025941 Bacteria 2563
63 Ga0207651_10073899 3300025960 Unclassified 2426
64 Ga0207651_10136413 3300025960 Bacteria 1888
65 Ga0207712_10047600 3300025961 Bacteria 2978
66 Ga0207428_10031400 3300027907 Bacteria 4381
67 Ga0207428_10282860 3300027907 Bacteria 1231
68 Ga0307416_100111766 3300032002 Bacteria 2410
69 Ga0307411_10029628 3300032005 Bacteria 3346
70 Ga0373958_0023638 3300034819 Bacteria 1158
71 Ga0373934_0039468 3300035086 Bacteria 1862
72 Ga0373942_0033387 3300035207 Bacteria 1372
73 Ga0373931_0083587 3300035691 Bacteria 1766
74 Ga0373935_0155430 3300035692 Bacteria 1555
75 Ga0372808_007950 3300036459 Bacteria 1461
76 Ga0395900_0070726 3300037418 Bacteria 3587
77 Ga0395905_0033591 3300037471 Bacteria 4817
78 Ga0436364_0174146 3300037853 Bacteria 60383
79 Ga0436364_0420226 3300037853 Bacteria 1248
80 Ga0436365_0924869 3300039437 Bacteria 11195
81 Ga0436361_0936883 3300039447 Bacteria 1939
82 Ga0436363_1293080 3300039450 Bacteria 1149
83 Ga0439441_000422 3300042001 Bacteria 4467
84 Ga0439441_005548 3300042001 Bacteria 1968
85 Ga0439441_016973 3300042001 Bacteria 1303
86 Ga0450911_000042 3300042115 Bacteria 57773
87 Ga0450911_000146 3300042115 Bacteria 28932
88 Ga0450911_001221 3300042115 Bacteria 6234
89 Ga0439446_0012253 3300042156 Bacteria 2341
90 Ga0439464_0006144 3300042439 Bacteria 3123
91 Ga0451577_0227886 3300042876 Bacteria 1685
92 Ga0451576_0125431 3300045051 Bacteria 2675
93 Ga0466958_0034801 3300045836 Bacteria 3007
94 Ga0495629_0112836 3300046459 Bacteria 1895
95 Ga0495651_0188585 3300046462 Bacteria 1453
96 Ga0495630_0282119 3300046517 Bacteria 1269
97 Ga0495645_0146589 3300046543 Bacteria 1644
98 Ga0495656_0050576 3300046615 Bacteria 1775
99 Ga0495658_0129622 3300046683 Bacteria 1534
100 Ga0495674_0179666 3300047319 Bacteria 1763
101 Ga0495680_0218931 3300047322 Bacteria 1360
102 Ga0496100_0407693 3300048903 Bacteria 1036
103 Ga0496101_0090711 3300048904 Bacteria 2273
104 Ga0496101_0131773 3300048904 Bacteria 1899
105 Ga0496102_0038933 3300048905 Bacteria 4294
106 Ga0496102_0395559 3300048905 Bacteria 1299
107 Ga0496104_0162502 3300048907 Bacteria 2142
108 Ga0496105_0192042 3300048908 Bacteria 1669
109 Ga0496108_0034557 3300048911 Bacteria 4201
110 Ga0496108_0231937 3300048911 Bacteria 1605
111 Ga0496109_0214733 3300048912 Bacteria 1809
112 Ga0496109_0244324 3300048912 Bacteria 1690
113 Ga0496109_0488050 3300048912 Bacteria 1163
114 Ga0496110_0051742 3300048913 Bacteria 3609
115 Ga0496110_0298357 3300048913 Bacteria 1468
116 Ga0496111_0154621 3300048914 Bacteria 1702
117 Ga0496112_0109689 3300048915 Bacteria 2730
118 Ga0496113_0041811 3300048916 Bacteria 3385
119 Ga0496115_0400841 3300048918 Bacteria 1113
120 Ga0496121_0008786 3300048924 Bacteria 11780
121 Ga0496121_0034719 3300048924 Bacteria 4535
122 Ga0496125_0001120 3300048928 Bacteria 40923
123 Ga0496125_0012596 3300048928 Bacteria 8379
124 Ga0496125_0053886 3300048928 Bacteria 3293
125 Ga0496126_0001509 3300048929 Bacteria 35945
126 Ga0496126_0166036 3300048929 Bacteria 1884
127 Ga0501034_0032549 3300049571 Bacteria 5293
128 Ga0501038_0070999 3300049574 Plasmid 2955
129 Ga0501047_0046940 3300049581 Bacteria 4173
130 Ga0501070_0080717 3300049586 Plasmid 2691
131 Ga0501074_0058666 3300049590 Plasmid 2773
132 Ga0501262_000167 3300049759 Bacteria 8158
133 Ga0501035_0019892 3300049822 Bacteria 6167
134 Ga0501044_0011381 3300049823 Bacteria 9636
135 nmdc:mga00v17_37837_c1 3300050491 Bacteria 2883
136 nmdc:mga07m45_63617_c2 3300050496 Bacteria 1609
137 nmdc:mga0qj67_193950_c1 3300050509 Bacteria 1650
138 nmdc:mga08y16_142836_c1 3300050511 Bacteria 2489
139 nmdc:mga0n895_804423_c1 3300050512 Bacteria 930
140 nmdc:mga0rr50_143984_c1 3300050513 Bacteria 1920
141 nmdc:mga08x19_1258_c1 3300050514 Bacteria 15735
142 Ga0495619_0023201 3300053085 Bacteria 3976
143 Ga0500642_0000394 3300053130 Bacteria 14348
144 Ga0500590_003179 3300053148 Bacteria 7505
145 2881102479 2881101125 Bacteria 4590519
146 2929166833 2929160207 Bacteria 9075316
147 Ga0207693_10235951
148 JGI25151J46595_10004115
149 Ga0055536_1000205
150 Ga0055530_10004514
151 Ga0055540_1000588
152 Ga0055540_1001355
153 Ga0055531_10000414
154 Ga0070676_10040572
155 Ga0070670_100031231
156 Ga0068868_100228380
157 Ga0070673_100549475
158 Ga0070714_100115108
159 Ga0070713_100232911
160 Ga0070710_10122170
161 Ga0070708_100027013
162 Ga0070681_10013231
163 Ga0070707_100007427
164 Ga0070679_100132073
165 Ga0068855_100356579
166 Ga0068864_100084170
167 Ga0081539_10005945
168 Ga0070717_10031634
169 Ga0075364_10010564
170 Ga0075364_10128130
171 Ga0075364_10151488
172 Ga0075428_100007499
173 Ga0075436_100182919
174 Ga0099794_10012562
175 Ga0111539_10176142
176 Ga0114129_10386164
177 Ga0105243_10102290
178 Ga0105248_10199268
179 Ga0105249_10246050
180 Ga0105246_10206981
181 Ga0157378_10484364
182 Ga0163162_10622236
183 Ga0157375_10045885
184 Ga0163163_10091065
185 Ga0157380_10329300
186 Ga0182008_10000254
187 Ga0182008_10020992
188 Ga0213875_10000009
189 Ga0209676_1000071
190 Ga0209676_1000706
191 Ga0209025_1000786
192 Ga0209050_1000868
193 Ga0209051_1000150
194 Ga0209051_1000169
195 Ga0209257_1000862
196 Ga0209257_1006280
197 Ga0207697_10127597
198 Ga0207707_10026512
199 Ga0207652_10138267
200 Ga0207646_10009700
201 Ga0207681_10083702
202 Ga0207650_10063383
203 Ga0207687_10158448
204 Ga0207664_10020863
205 Ga0207664_10374800
206 Ga0207665_10172306
207 Ga0207691_10196759
208 Ga0207711_10100099
209 Ga0207651_10073899
210 Ga0207651_10136413
211 Ga0207712_10047600
212 Ga0207428_10031400
213 Ga0207428_10282860
214 Ga0307416_100111766
215 Ga0307411_10029628
216 Ga0373958_0023638
217 Ga0373934_0039468
218 Ga0373942_0033387
219 Ga0373931_0083587
220 Ga0373935_0155430
221 Ga0372808_007950
222 Ga0395900_0070726
223 Ga0395905_0033591
224 Ga0436364_0174146
225 Ga0436364_0420226
226 Ga0436365_0924869
227 Ga0436361_0936883
228 Ga0436363_1293080
229 Ga0439441_000422
230 Ga0439441_005548
231 Ga0439441_016973
232 Ga0450911_000042
233 Ga0450911_000146
234 Ga0450911_001221
235 Ga0439446_0012253
236 Ga0439464_0006144
237 Ga0451577_0227886
238 Ga0451576_0125431
239 Ga0466958_0034801
240 Ga0495629_0112836
241 Ga0495651_0188585
242 Ga0495630_0282119
243 Ga0495645_0146589
244 Ga0495656_0050576
245 Ga0495658_0129622
246 Ga0495674_0179666
247 Ga0495680_0218931
248 Ga0496100_0407693
249 Ga0496101_0090711
250 Ga0496101_0131773
251 Ga0496102_0038933
252 Ga0496102_0395559
253 Ga0496104_0162502
254 Ga0496105_0192042
255 Ga0496108_0034557
256 Ga0496108_0231937
257 Ga0496109_0214733
258 Ga0496109_0244324
259 Ga0496109_0488050
260 Ga0496110_0051742
261 Ga0496110_0298357
262 Ga0496111_0154621
263 Ga0496112_0109689
264 Ga0496113_0041811
265 Ga0496115_0400841
266 Ga0496121_0008786
267 Ga0496121_0034719
268 Ga0496125_0001120
269 Ga0496125_0012596
270 Ga0496125_0053886
271 Ga0496126_0001509
272 Ga0496126_0166036
273 Ga0501034_0032549
274 Ga0501038_0070999
275 Ga0501047_0046940
276 Ga0501070_0080717
277 Ga0501074_0058666
278 Ga0501262_000167
279 Ga0501035_0019892
280 Ga0501044_0011381
281 nmdc:mga00v17_37837_c1
282 nmdc:mga07m45_63617_c2
283 nmdc:mga0qj67_193950_c1
284 nmdc:mga08y16_142836_c1
285 nmdc:mga0n895_804423_c1
286 nmdc:mga0rr50_143984_c1
287 nmdc:mga08x19_1258_c1
288 Ga0495619_0023201
289 Ga0500642_0000394
290 Ga0500590_003179
291 2881102479
292 2929166833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

74

348

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9614 31 326
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9582 31 326
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.944 30 326
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9409 30 326
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9216 30 325
ID Description Score Start End Superfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9574 130 250 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9492 130 247 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9374 30 326 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9335 30 326 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9281 30 326 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A7H0GIP4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9768 55 326
AF-A0A3A3FMR4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9703 48 326
AF-A0A6S7A956-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9683 73 325
AF-A0A854PPI3-F1-model_v4 deleted 0.9678 38 326
AF-H0BVV3-F1-model_v4 Uncharacterized protein 0.9666 27 326

Map