F196890

General Info

Members Datasets Scaffolds Average Seq Length
146 110 292 187

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100025308|Ga0070694_1000253082
Length 209
Sequence VISLPLRPPNNASRRLPGEPTFRRVKTQYYTASSLDGFIADSHDSLEWLFPLGNVADTSYPAFIREVGALAMGSATYEWMLRHVVGAKQPQPWPYQQPTWVFTTRTLPSAPGADIRFVRGDIRPAHQAMVAAAAGKNVWIVGGGDLAGQFYDHGLLDELFVQVGSVTLGAGKPLLPRAITSPPLRLVSVRAVGTGFAELHYELPRHPSK

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
67 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
68 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
69 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
77 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
78 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
101 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
106 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
107 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.85
Nodule 0
Rhizoplane 7.53
Rhizosphere 85.62
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100025308 3300005444 Bacteria 3839
2 Ga0055540_1001512 3300003792 Bacteria 13781
3 Ga0070670_100072907 3300005331 Bacteria 2949
4 Ga0070677_10132563 3300005333 Bacteria 1139
5 Ga0070680_100029042 3300005336 Bacteria 4440
6 Ga0070661_100869127 3300005344 Bacteria 743
7 Ga0070692_10221084 3300005345 Bacteria 1120
8 Ga0070674_100381970 3300005356 Bacteria 1146
9 Ga0070701_10040539 3300005438 Bacteria 2367
10 Ga0070705_100231057 3300005440 Bacteria 1287
11 Ga0070662_100069920 3300005457 Bacteria 2586
12 Ga0070699_100000063 3300005518 Bacteria 100440
13 Ga0070679_100028942 3300005530 Bacteria 5464
14 Ga0070672_100188493 3300005543 Bacteria 1721
15 Ga0070695_100037193 3300005545 Bacteria 3067
16 Ga0070695_100211416 3300005545 Bacteria 1393
17 Ga0070665_100582030 3300005548 Bacteria 1132
18 Ga0070704_100340693 3300005549 Unclassified 1262
19 Ga0070702_100366921 3300005615 Bacteria 1019
20 Ga0068859_100072734 3300005617 Bacteria 3475
21 Ga0068861_100221870 3300005719 Bacteria 1598
22 Ga0068861_100319174 3300005719 Bacteria 1352
23 Ga0068858_100221660 3300005842 Bacteria 1791
24 Ga0068860_100251833 3300005843 Bacteria 1720
25 Ga0068862_100104769 3300005844 Bacteria 2478
26 Ga0075364_10006723 3300006051 Bacteria 6780
27 Ga0075366_10035240 3300006195 Unclassified 2950
28 Ga0075428_100663192 3300006844 Bacteria 1112
29 Ga0075434_100047063 3300006871 Bacteria 4281
30 Ga0075434_100475982 3300006871 Unclassified 1270
31 Ga0097620_100072734 3300006931 Bacteria 3475
32 Ga0111539_10129273 3300009094 Unclassified 2958
33 Ga0114129_10001718 3300009147 Bacteria 29903
34 Ga0105248_10715279 3300009177 Bacteria 1130
35 Ga0105249_10221567 3300009553 Bacteria 1861
36 Ga0157373_10154023 3300013100 Bacteria 1617
37 Ga0157372_10530116 3300013307 Bacteria 1373
38 Ga0157372_11083426 3300013307 Unclassified 927
39 Ga0157375_10447876 3300013308 Bacteria 1457
40 Ga0157380_11136514 3300014326 Bacteria 822
41 Ga0157380_11359277 3300014326 Bacteria 759
42 Ga0157379_11244012 3300014968 Unclassified 717
43 Ga0206354_11144108 3300020081 Bacteria 1028
44 Ga0209673_1018324 3300025273 Bacteria 2550
45 Ga0209673_1042241 3300025273 Bacteria 1284
46 Ga0209758_1031050 3300025297 Bacteria 2200
47 Ga0209051_1000587 3300025303 Bacteria 43099
48 Ga0209257_1000137 3300025304 Bacteria 204210
49 Ga0207707_10758888 3300025912 Bacteria 811
50 Ga0207652_10028800 3300025921 Bacteria 4636
51 Ga0207650_10087069 3300025925 Bacteria 2379
52 Ga0207706_10164691 3300025933 Bacteria 1949
53 Ga0207704_10035780 3300025938 Bacteria 2850
54 Ga0207691_10005402 3300025940 Bacteria 12336
55 Ga0207691_10256144 3300025940 Bacteria 1509
56 Ga0207703_10221786 3300026035 Bacteria 1691
57 Ga0207675_100786311 3300026118 Bacteria 964
58 Ga0265327_10001168 3300031251 Bacteria 35627
59 Ga0307408_100000138 3300031548 Bacteria 81192
60 Ga0307408_100025154 3300031548 Bacteria 4075
61 Ga0307408_100029113 3300031548 Bacteria 3823
62 Ga0307408_100179144 3300031548 Bacteria 1698
63 Ga0307408_100572676 3300031548 Bacteria 999
64 Ga0316578_10105229 3300031728 Bacteria 1693
65 Ga0307405_10060857 3300031731 Bacteria 2384
66 Ga0307413_10029182 3300031824 Bacteria 3083
67 Ga0307413_10066357 3300031824 Bacteria 2251
68 Ga0307410_10025945 3300031852 Bacteria 3682
69 Ga0307410_10033652 3300031852 Bacteria 3311
70 Ga0307410_10133253 3300031852 Bacteria 1828
71 Ga0307406_10001332 3300031901 Bacteria 13869
72 Ga0307406_10020240 3300031901 Bacteria 3916
73 Ga0307406_10145905 3300031901 Bacteria 1681
74 Ga0307406_10690653 3300031901 Bacteria 851
75 Ga0307407_10052463 3300031903 Bacteria 2342
76 Ga0307407_10070644 3300031903 Bacteria 2076
77 Ga0307407_10214824 3300031903 Bacteria 1297
78 Ga0307407_10497143 3300031903 Bacteria 893
79 Ga0307412_10043227 3300031911 Bacteria 2933
80 Ga0307412_10052513 3300031911 Bacteria 2699
81 Ga0307412_10099000 3300031911 Bacteria 2057
82 Ga0307412_10236680 3300031911 Bacteria 1410
83 Ga0307409_100005499 3300031995 Bacteria 7306
84 Ga0307409_100054024 3300031995 Bacteria 3091
85 Ga0307409_100098973 3300031995 Bacteria 2413
86 Ga0307409_100128465 3300031995 Bacteria 2161
87 Ga0307409_101091330 3300031995 Unclassified 819
88 Ga0307416_100057714 3300032002 Bacteria 3142
89 Ga0307416_100190327 3300032002 Bacteria 1934
90 Ga0307416_101476709 3300032002 Bacteria 785
91 Ga0307414_10050215 3300032004 Bacteria 2888
92 Ga0307411_10203067 3300032005 Bacteria 1524
93 Ga0307411_10581478 3300032005 Bacteria 960
94 Ga0307415_100018942 3300032126 Bacteria 4169
95 Ga0316574_0064754 3300035398 Bacteria 2300
96 Ga0439445_0027475 3300042004 Bacteria 1462
97 Ga0439462_0006138 3300042015 Bacteria 2979
98 Ga0439446_0007434 3300042156 Bacteria 2880
99 Ga0439446_0155316 3300042156 Bacteria 754
100 Ga0439434_0046948 3300042435 Bacteria 1333
101 Ga0451577_0040394 3300042876 Bacteria 4188
102 Ga0451577_0711045 3300042876 Bacteria 910
103 Ga0453683_0000012 3300044673 Bacteria 376341
104 Ga0466965_0532974 3300044683 Bacteria 661
105 Ga0453684_0033857 3300044712 Bacteria 7109
106 Ga0451576_0000026 3300045051 Bacteria 427585
107 Ga0495653_0015971 3300046463 Bacteria 6121
108 Ga0495620_0001189 3300046515 Bacteria 15934
109 Ga0495586_0282981 3300046535 Unclassified 949
110 Ga0495659_0034305 3300046664 Bacteria 1784
111 Ga0496100_0943112 3300048903 Bacteria 678
112 Ga0496101_0087326 3300048904 Bacteria 2315
113 Ga0496102_0039671 3300048905 Bacteria 4255
114 Ga0496104_0199073 3300048907 Bacteria 1915
115 Ga0496105_0186736 3300048908 Bacteria 1696
116 Ga0496106_0038132 3300048909 Bacteria 3596
117 Ga0496108_0043377 3300048911 Bacteria 3757
118 Ga0496110_0032456 3300048913 Bacteria 4510
119 Ga0496111_0113349 3300048914 Bacteria 1998
120 Ga0496112_0135416 3300048915 Bacteria 2434
121 Ga0496115_0503154 3300048918 Bacteria 973
122 Ga0501031_0006740 3300049568 Bacteria 7490
123 Ga0501036_0851220 3300049572 Bacteria 750
124 Ga0501040_0020906 3300049576 Bacteria 4364
125 Ga0501040_0471004 3300049576 Bacteria 905
126 Ga0501041_0089151 3300049577 Bacteria 1904
127 Ga0501042_0007300 3300049578 Bacteria 7232
128 Ga0501048_0099085 3300049582 Bacteria 2056
129 Ga0501071_0056130 3300049587 Bacteria 2844
130 Ga0501071_0336337 3300049587 Bacteria 1148
131 Ga0501071_0665660 3300049587 Bacteria 801
132 Ga0501072_0343317 3300049588 Bacteria 1186
133 Ga0501074_0375902 3300049590 Bacteria 1008
134 Ga0501076_0974736 3300049592 Bacteria 699
135 Ga0501077_0307869 3300049593 Bacteria 1010
136 Ga0501259_030758 3300049688 Bacteria 1012
137 Ga0501079_0292953 3300049741 Bacteria 1273
138 Ga0501079_0391213 3300049741 Bacteria 1090
139 Ga0501080_0189524 3300049742 Bacteria 1890
140 Ga0501081_0301525 3300049743 Bacteria 1175
141 Ga0501232_026103 3300049757 Bacteria 785
142 nmdc:mga00v17_36906_c1 3300050491 Bacteria 2915
143 nmdc:mga0k408_33223_c1 3300050493 Unclassified 2950
144 nmdc:mga08y16_91961_c1 3300050511 Bacteria 3161
145 nmdc:mga0n895_30766_c1 3300050512 Bacteria 5133
146 nmdc:mga0a205_439092_c1 3300050515 Bacteria 1166
147 Ga0070694_100025308
148 Ga0055540_1001512
149 Ga0070670_100072907
150 Ga0070677_10132563
151 Ga0070680_100029042
152 Ga0070661_100869127
153 Ga0070692_10221084
154 Ga0070674_100381970
155 Ga0070701_10040539
156 Ga0070705_100231057
157 Ga0070662_100069920
158 Ga0070699_100000063
159 Ga0070679_100028942
160 Ga0070672_100188493
161 Ga0070695_100037193
162 Ga0070695_100211416
163 Ga0070665_100582030
164 Ga0070704_100340693
165 Ga0070702_100366921
166 Ga0068859_100072734
167 Ga0068861_100221870
168 Ga0068861_100319174
169 Ga0068858_100221660
170 Ga0068860_100251833
171 Ga0068862_100104769
172 Ga0075364_10006723
173 Ga0075366_10035240
174 Ga0075428_100663192
175 Ga0075434_100047063
176 Ga0075434_100475982
177 Ga0097620_100072734
178 Ga0111539_10129273
179 Ga0114129_10001718
180 Ga0105248_10715279
181 Ga0105249_10221567
182 Ga0157373_10154023
183 Ga0157372_10530116
184 Ga0157372_11083426
185 Ga0157375_10447876
186 Ga0157380_11136514
187 Ga0157380_11359277
188 Ga0157379_11244012
189 Ga0206354_11144108
190 Ga0209673_1018324
191 Ga0209673_1042241
192 Ga0209758_1031050
193 Ga0209051_1000587
194 Ga0209257_1000137
195 Ga0207707_10758888
196 Ga0207652_10028800
197 Ga0207650_10087069
198 Ga0207706_10164691
199 Ga0207704_10035780
200 Ga0207691_10005402
201 Ga0207691_10256144
202 Ga0207703_10221786
203 Ga0207675_100786311
204 Ga0265327_10001168
205 Ga0307408_100000138
206 Ga0307408_100025154
207 Ga0307408_100029113
208 Ga0307408_100179144
209 Ga0307408_100572676
210 Ga0316578_10105229
211 Ga0307405_10060857
212 Ga0307413_10029182
213 Ga0307413_10066357
214 Ga0307410_10025945
215 Ga0307410_10033652
216 Ga0307410_10133253
217 Ga0307406_10001332
218 Ga0307406_10020240
219 Ga0307406_10145905
220 Ga0307406_10690653
221 Ga0307407_10052463
222 Ga0307407_10070644
223 Ga0307407_10214824
224 Ga0307407_10497143
225 Ga0307412_10043227
226 Ga0307412_10052513
227 Ga0307412_10099000
228 Ga0307412_10236680
229 Ga0307409_100005499
230 Ga0307409_100054024
231 Ga0307409_100098973
232 Ga0307409_100128465
233 Ga0307409_101091330
234 Ga0307416_100057714
235 Ga0307416_100190327
236 Ga0307416_101476709
237 Ga0307414_10050215
238 Ga0307411_10203067
239 Ga0307411_10581478
240 Ga0307415_100018942
241 Ga0316574_0064754
242 Ga0439445_0027475
243 Ga0439462_0006138
244 Ga0439446_0007434
245 Ga0439446_0155316
246 Ga0439434_0046948
247 Ga0451577_0040394
248 Ga0451577_0711045
249 Ga0453683_0000012
250 Ga0466965_0532974
251 Ga0453684_0033857
252 Ga0451576_0000026
253 Ga0495653_0015971
254 Ga0495620_0001189
255 Ga0495586_0282981
256 Ga0495659_0034305
257 Ga0496100_0943112
258 Ga0496101_0087326
259 Ga0496102_0039671
260 Ga0496104_0199073
261 Ga0496105_0186736
262 Ga0496106_0038132
263 Ga0496108_0043377
264 Ga0496110_0032456
265 Ga0496111_0113349
266 Ga0496112_0135416
267 Ga0496115_0503154
268 Ga0501031_0006740
269 Ga0501036_0851220
270 Ga0501040_0020906
271 Ga0501040_0471004
272 Ga0501041_0089151
273 Ga0501042_0007300
274 Ga0501048_0099085
275 Ga0501071_0056130
276 Ga0501071_0336337
277 Ga0501071_0665660
278 Ga0501072_0343317
279 Ga0501074_0375902
280 Ga0501076_0974736
281 Ga0501077_0307869
282 Ga0501259_030758
283 Ga0501079_0292953
284 Ga0501079_0391213
285 Ga0501080_0189524
286 Ga0501081_0301525
287 Ga0501232_026103
288 nmdc:mga00v17_36906_c1
289 nmdc:mga0k408_33223_c1
290 nmdc:mga08y16_91961_c1
291 nmdc:mga0n895_30766_c1
292 nmdc:mga0a205_439092_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

26

197

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8916 2 179
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8905 2 178
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8763 2 178
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8677 2 179
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8211 2 179
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8916 2 179 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8677 2 179 3.40.430.10
af_A0A1X7YGG3_447_560_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8297 159 179 3.30.70.240
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8294 2 177 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.821 2 177 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A0K2G8S9-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9512 1 181 GO:0008703
GO:0009231
AF-A0A6J4Q1X7-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9497 1 181 GO:0004146
GO:0008703
GO:0009231
AF-A0A560L2C1-F1-model_v4 deleted 0.9478 1 179
AF-A0A0K2G8S9-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9462 1 181 GO:0008703
GO:0009231
AF-A0A080NG26-F1-model_v4 deleted 0.9447 1 180

Map