F196653

General Info

Members Datasets Scaffolds Average Seq Length
146 96 292 57

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_11297874|Ga0070666_112978742
Length 59
Sequence MSALSYETVARFAQQGGTVYFTLLFAAGLLYALWPRHKAAFQRLALLPLEDHEDDDVQS

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
90 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
96 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 2.05
Rhizosphere 93.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_11297874 3300005335 Bacteria 543
2 Ga0070658_10172627 3300005327 Bacteria 1817
3 Ga0070658_10192591 3300005327 Bacteria 1719
4 Ga0070658_10626889 3300005327 Bacteria 932
5 Ga0070658_10668071 3300005327 Bacteria 902
6 Ga0070683_101688211 3300005329 Bacteria 609
7 Ga0070666_11186946 3300005335 Bacteria 568
8 Ga0070682_100390246 3300005337 Bacteria 1050
9 Ga0070660_100140402 3300005339 Bacteria 1938
10 Ga0070660_100270458 3300005339 Bacteria 1389
11 Ga0070689_101807724 3300005340 Bacteria 557
12 Ga0070668_100000104 3300005347 Bacteria 51950
13 Ga0070668_100012062 3300005347 Bacteria 6438
14 Ga0070669_100318095 3300005353 Bacteria 1256
15 Ga0070671_101054128 3300005355 Bacteria 713
16 Ga0070659_100161726 3300005366 Bacteria 1831
17 Ga0070659_101948852 3300005366 Bacteria 527
18 Ga0070667_100034126 3300005367 Bacteria 4255
19 Ga0070667_100329060 3300005367 Bacteria 1380
20 Ga0068867_100407166 3300005459 Bacteria 1149
21 Ga0070698_100870715 3300005471 Bacteria 846
22 Ga0070679_101378119 3300005530 Bacteria 651
23 Ga0068853_100595284 3300005539 Bacteria 1050
24 Ga0070702_101484914 3300005615 Bacteria 557
25 Ga0068859_100038523 3300005617 Bacteria 4796
26 Ga0068859_101243891 3300005617 Bacteria 820
27 Ga0068864_101589053 3300005618 Bacteria 658
28 Ga0068864_102132164 3300005618 Bacteria 567
29 Ga0068866_11233702 3300005718 Bacteria 541
30 Ga0068861_100599367 3300005719 Bacteria 1011
31 Ga0068863_100256457 3300005841 Bacteria 1690
32 Ga0068863_100500885 3300005841 Bacteria 1196
33 Ga0068860_100000023 3300005843 Bacteria 279076
34 Ga0068860_100089943 3300005843 Bacteria 2923
35 Ga0068862_100004458 3300005844 Bacteria 11811
36 Ga0068862_100296204 3300005844 Bacteria 1487
37 Ga0068862_100310617 3300005844 Bacteria 1453
38 Ga0097620_100038523 3300006931 Bacteria 4796
39 Ga0097620_101243762 3300006931 Bacteria 820
40 Ga0105240_10025677 3300009093 Bacteria 7739
41 Ga0105240_10067745 3300009093 Bacteria 4424
42 Ga0105245_10119816 3300009098 Bacteria 2457
43 Ga0105247_10281271 3300009101 Bacteria 1148
44 Ga0105241_10153826 3300009174 Bacteria 1884
45 Ga0105241_10639169 3300009174 Bacteria 965
46 Ga0105242_10418535 3300009176 Bacteria 1255
47 Ga0105248_10005133 3300009177 Bacteria 14449
48 Ga0105248_12846258 3300009177 Bacteria 552
49 Ga0105237_10711363 3300009545 Bacteria 1011
50 Ga0105237_11462522 3300009545 Bacteria 690
51 Ga0105238_10007876 3300009551 Bacteria 10659
52 Ga0105238_10017767 3300009551 Bacteria 7231
53 Ga0105238_10814890 3300009551 Bacteria 949
54 Ga0105238_12146840 3300009551 Bacteria 593
55 Ga0105249_10052696 3300009553 Bacteria 3716
56 Ga0105239_10349716 3300010375 Bacteria 1669
57 Ga0105239_12777988 3300010375 Bacteria 571
58 Ga0157369_10949268 3300013105 Bacteria 881
59 Ga0163163_10504900 3300014325 Bacteria 1271
60 Ga0163163_12975788 3300014325 Bacteria 528
61 Ga0157380_11264179 3300014326 Bacteria 784
62 Ga0157379_10573115 3300014968 Bacteria 1052
63 Ga0163161_11598037 3300017792 Bacteria 575
64 Ga0213876_10000185 3300021384 Bacteria 64516
65 Ga0209026_1009822 3300025250 Bacteria 1841
66 Ga0207680_10712140 3300025903 Bacteria 719
67 Ga0207705_10147297 3300025909 Bacteria 1762
68 Ga0207705_10182402 3300025909 Bacteria 1585
69 Ga0207705_10569442 3300025909 Bacteria 880
70 Ga0207705_10714486 3300025909 Bacteria 779
71 Ga0207654_10096765 3300025911 Bacteria 1811
72 Ga0207654_10386385 3300025911 Bacteria 970
73 Ga0207695_10001391 3300025913 Bacteria 40900
74 Ga0207671_10563947 3300025914 Bacteria 908
75 Ga0207657_10090522 3300025919 Bacteria 2553
76 Ga0207657_10265461 3300025919 Bacteria 1365
77 Ga0207657_10319236 3300025919 Bacteria 1228
78 Ga0207652_11068222 3300025921 Bacteria 707
79 Ga0207694_10009995 3300025924 Bacteria 7154
80 Ga0207694_10015597 3300025924 Bacteria 5730
81 Ga0207694_11244649 3300025924 Bacteria 630
82 Ga0207694_11438701 3300025924 Bacteria 582
83 Ga0207687_10312373 3300025927 Bacteria 1270
84 Ga0207644_10238174 3300025931 Bacteria 1448
85 Ga0207690_10129361 3300025932 Bacteria 1846
86 Ga0207711_10000331 3300025941 Bacteria 50472
87 Ga0207711_11121463 3300025941 Bacteria 728
88 Ga0207689_11564692 3300025942 Bacteria 549
89 Ga0207712_10879677 3300025961 Bacteria 791
90 Ga0207668_10017846 3300025972 Bacteria 4454
91 Ga0207668_10033013 3300025972 Bacteria 3426
92 Ga0207658_10057559 3300025986 Bacteria 2889
93 Ga0207658_10847935 3300025986 Bacteria 831
94 Ga0207703_10366407 3300026035 Bacteria 1330
95 Ga0207639_10179139 3300026041 Bacteria 1802
96 Ga0207641_10179146 3300026088 Bacteria 1940
97 Ga0207641_10478105 3300026088 Bacteria 1207
98 Ga0207676_10778704 3300026095 Bacteria 932
99 Ga0207675_100154956 3300026118 Bacteria 2183
100 Ga0207698_10807286 3300026142 Bacteria 941
101 Ga0268265_10002125 3300028380 Bacteria 15368
102 Ga0268265_10043072 3300028380 Bacteria 3353
103 Ga0268265_10832982 3300028380 Bacteria 901
104 Ga0268264_10000008 3300028381 Bacteria 773387
105 Ga0268264_10187212 3300028381 Bacteria 1884
106 Ga0265326_10084248 3300028558 Bacteria 899
107 Ga0265334_10006497 3300028573 Bacteria 5032
108 Ga0265334_10261359 3300028573 Bacteria 595
109 Ga0265338_10119806 3300028800 Bacteria 2100
110 Ga0265338_10216205 3300028800 Bacteria 1435
111 Ga0265338_10410532 3300028800 Bacteria 964
112 Ga0265338_10933429 3300028800 Bacteria 590
113 Ga0265340_10012510 3300031247 Bacteria 4480
114 Ga0265327_10001770 3300031251 Bacteria 25518
115 Ga0265327_10067728 3300031251 Bacteria 1798
116 Ga0265314_10265791 3300031711 Bacteria 977
117 Ga0307413_10749119 3300031824 Bacteria 816
118 Ga0307416_103251496 3300032002 Bacteria 544
119 Ga0307414_10019469 3300032004 Bacteria 4207
120 Ga0307414_10215312 3300032004 Bacteria 1573
121 Ga0307411_10080213 3300032005 Bacteria 2243
122 Ga0307510_10185254 3300033180 Bacteria 1638
123 Ga0373950_0078355 3300034818 Bacteria 687
124 Ga0373936_0002153 3300035113 Bacteria 7338
125 Ga0373955_0766675 3300035172 Bacteria 593
126 Ga0373933_0931149 3300035724 Bacteria 572
127 Ga0373937_0816436 3300036401 Bacteria 881
128 Ga0373937_1101917 3300036401 Bacteria 743
129 Ga0395899_0000137 3300037312 Bacteria 111924
130 Ga0395900_0000108 3300037418 Bacteria 147706
131 Ga0395898_0011374 3300037466 Bacteria 9244
132 Ga0395898_1154329 3300037466 Bacteria 707
133 Ga0395905_0042195 3300037471 Bacteria 4280
134 Ga0395905_0111371 3300037471 Bacteria 2570
135 Ga0436364_0029658 3300037853 Bacteria 1783
136 Ga0395901_0000050 3300038443 Bacteria 171046
137 Ga0436365_0435360 3300039437 Bacteria 60593
138 Ga0495663_0044048 3300046525 Bacteria 1365
139 Ga0495622_0432868 3300046557 Bacteria 565
140 Ga0496105_1127421 3300048908 Bacteria 581
141 Ga0496112_0086861 3300048915 Bacteria 3094
142 Ga0496112_0145435 3300048915 Bacteria 2339
143 Ga0501046_0987238 3300049580 Bacteria 585
144 Ga0501047_0000893 3300049581 Bacteria 30459
145 Ga0500635_0104650 3300053080 Bacteria 1045
146 Ga0500642_0461794 3300053130 Bacteria 543
147 Ga0070666_11297874
148 Ga0070658_10172627
149 Ga0070658_10192591
150 Ga0070658_10626889
151 Ga0070658_10668071
152 Ga0070683_101688211
153 Ga0070666_11186946
154 Ga0070682_100390246
155 Ga0070660_100140402
156 Ga0070660_100270458
157 Ga0070689_101807724
158 Ga0070668_100000104
159 Ga0070668_100012062
160 Ga0070669_100318095
161 Ga0070671_101054128
162 Ga0070659_100161726
163 Ga0070659_101948852
164 Ga0070667_100034126
165 Ga0070667_100329060
166 Ga0068867_100407166
167 Ga0070698_100870715
168 Ga0070679_101378119
169 Ga0068853_100595284
170 Ga0070702_101484914
171 Ga0068859_100038523
172 Ga0068859_101243891
173 Ga0068864_101589053
174 Ga0068864_102132164
175 Ga0068866_11233702
176 Ga0068861_100599367
177 Ga0068863_100256457
178 Ga0068863_100500885
179 Ga0068860_100000023
180 Ga0068860_100089943
181 Ga0068862_100004458
182 Ga0068862_100296204
183 Ga0068862_100310617
184 Ga0097620_100038523
185 Ga0097620_101243762
186 Ga0105240_10025677
187 Ga0105240_10067745
188 Ga0105245_10119816
189 Ga0105247_10281271
190 Ga0105241_10153826
191 Ga0105241_10639169
192 Ga0105242_10418535
193 Ga0105248_10005133
194 Ga0105248_12846258
195 Ga0105237_10711363
196 Ga0105237_11462522
197 Ga0105238_10007876
198 Ga0105238_10017767
199 Ga0105238_10814890
200 Ga0105238_12146840
201 Ga0105249_10052696
202 Ga0105239_10349716
203 Ga0105239_12777988
204 Ga0157369_10949268
205 Ga0163163_10504900
206 Ga0163163_12975788
207 Ga0157380_11264179
208 Ga0157379_10573115
209 Ga0163161_11598037
210 Ga0213876_10000185
211 Ga0209026_1009822
212 Ga0207680_10712140
213 Ga0207705_10147297
214 Ga0207705_10182402
215 Ga0207705_10569442
216 Ga0207705_10714486
217 Ga0207654_10096765
218 Ga0207654_10386385
219 Ga0207695_10001391
220 Ga0207671_10563947
221 Ga0207657_10090522
222 Ga0207657_10265461
223 Ga0207657_10319236
224 Ga0207652_11068222
225 Ga0207694_10009995
226 Ga0207694_10015597
227 Ga0207694_11244649
228 Ga0207694_11438701
229 Ga0207687_10312373
230 Ga0207644_10238174
231 Ga0207690_10129361
232 Ga0207711_10000331
233 Ga0207711_11121463
234 Ga0207689_11564692
235 Ga0207712_10879677
236 Ga0207668_10017846
237 Ga0207668_10033013
238 Ga0207658_10057559
239 Ga0207658_10847935
240 Ga0207703_10366407
241 Ga0207639_10179139
242 Ga0207641_10179146
243 Ga0207641_10478105
244 Ga0207676_10778704
245 Ga0207675_100154956
246 Ga0207698_10807286
247 Ga0268265_10002125
248 Ga0268265_10043072
249 Ga0268265_10832982
250 Ga0268264_10000008
251 Ga0268264_10187212
252 Ga0265326_10084248
253 Ga0265334_10006497
254 Ga0265334_10261359
255 Ga0265338_10119806
256 Ga0265338_10216205
257 Ga0265338_10410532
258 Ga0265338_10933429
259 Ga0265340_10012510
260 Ga0265327_10001770
261 Ga0265327_10067728
262 Ga0265314_10265791
263 Ga0307413_10749119
264 Ga0307416_103251496
265 Ga0307414_10019469
266 Ga0307414_10215312
267 Ga0307411_10080213
268 Ga0307510_10185254
269 Ga0373950_0078355
270 Ga0373936_0002153
271 Ga0373955_0766675
272 Ga0373933_0931149
273 Ga0373937_0816436
274 Ga0373937_1101917
275 Ga0395899_0000137
276 Ga0395900_0000108
277 Ga0395898_0011374
278 Ga0395898_1154329
279 Ga0395905_0042195
280 Ga0395905_0111371
281 Ga0436364_0029658
282 Ga0395901_0000050
283 Ga0436365_0435360
284 Ga0495663_0044048
285 Ga0495622_0432868
286 Ga0496105_1127421
287 Ga0496112_0086861
288 Ga0496112_0145435
289 Ga0501046_0987238
290 Ga0501047_0000893
291 Ga0500635_0104650
292 Ga0500642_0461794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05545

FixQ

Cbb3-type cytochrome oxidase component FixQ

4

52

0.98

Map