F196331

General Info

Members Datasets Scaffolds Average Seq Length
146 130 107 125

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1000205|JGI25160J50197_100020546
Length 144
Sequence MFYIVRMTNHTASWRFPTRPQMEKYGSSLTIDRKSSPKGAVGPADDLPPEYWQSLLDDPRVDGPDPGPGPSGRTLRLDQIPKHLLRVSCRRCARTVEIQMVDAIRLYGRDAVWRDVGQRLLDKTCTQRTGRHEEDGCWPSYDAP

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
3 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
4 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
5 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
6 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
7 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
8 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
9 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
10 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
11 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
12 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
13 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
14 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
15 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
16 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
17 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
18 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
19 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
20 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
21 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
22 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
45 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
46 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
77 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
78 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
97 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
114 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
115 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
116 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
117 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
118 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
119 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
120 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
121 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
122 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
123 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
124 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
125 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
126 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
127 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
128 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
129 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
130 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.29
Metatranscriptomes 0
Isolates 26.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.16
Nodule 26.03
Rhizoplane 0.68
Rhizosphere 58.22
Stem 0
Stem Tuber 0
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1006654 3300000546 Bacteria 1252
2 JGI25160J50197_1000205 3300003354 Bacteria 49327
3 Ga0055531_10001353 3300003794 Bacteria 18264
4 Ga0070680_100040726 3300005336 Bacteria 3764
5 Ga0070660_100067241 3300005339 Bacteria 2792
6 Ga0070668_100022686 3300005347 Bacteria 4745
7 Ga0070675_101190012 3300005354 Bacteria 702
8 Ga0070674_100120386 3300005356 Bacteria 1943
9 Ga0070673_100716395 3300005364 Bacteria 920
10 Ga0070714_100848566 3300005435 Bacteria 886
11 Ga0070701_10167301 3300005438 Bacteria 1278
12 Ga0070681_10069565 3300005458 Bacteria 3486
13 Ga0070681_10431209 3300005458 Bacteria 1230
14 Ga0068867_100109288 3300005459 Bacteria 2122
15 Ga0070679_100055501 3300005530 Bacteria 3944
16 Ga0070693_101413754 3300005547 Bacteria 541
17 Ga0070665_100641616 3300005548 Bacteria 1075
18 Ga0070665_100979707 3300005548 Bacteria 858
19 Ga0068856_100750105 3300005614 Bacteria 996
20 Ga0068861_100049336 3300005719 Bacteria 3186
21 Ga0068863_100271164 3300005841 Bacteria 1643
22 Ga0068862_100430660 3300005844 Bacteria 1240
23 Ga0081540_1015945 3300005983 Bacteria 4734
24 Ga0068871_101621126 3300006358 Bacteria 613
25 Ga0099825_1023048 3300006941 Bacteria 3893
26 Ga0099824_1012684 3300006942 Bacteria 9072
27 Ga0099823_1000010 3300006944 Bacteria 98544
28 Ga0105243_10376060 3300009148 Bacteria 1312
29 Ga0105237_10267307 3300009545 Bacteria 1713
30 Ga0105249_10250506 3300009553 Bacteria 1756
31 Ga0105239_11961492 3300010375 Bacteria 679
32 Ga0157369_10457808 3300013105 Bacteria 1321
33 Ga0157378_10002726 3300013297 Bacteria 15728
34 Ga0163162_10242208 3300013306 Bacteria 1934
35 Ga0157375_13402120 3300013308 Bacteria 530
36 Ga0157380_10023315 3300014326 Bacteria 4668
37 Ga0163161_10056590 3300017792 Bacteria 2848
38 Ga0163161_10425089 3300017792 Bacteria 1070
39 Ga0214544_1001540 3300021320 Bacteria 48145
40 Ga0209233_1040139 3300025261 Bacteria 1020
41 Ga0207426_1000138 3300025302 Bacteria 196119
42 Ga0207426_1001448 3300025302 Bacteria 19646
43 Ga0207426_1045896 3300025302 Bacteria 1326
44 Ga0209257_1000836 3300025304 Bacteria 44366
45 Ga0207688_10099295 3300025901 Bacteria 1679
46 Ga0207707_10006725 3300025912 Bacteria 10041
47 Ga0207671_10704213 3300025914 Bacteria 803
48 Ga0207663_10024338 3300025916 Bacteria 3486
49 Ga0207660_10029897 3300025917 Bacteria 3742
50 Ga0207657_11038614 3300025919 Unclassified 628
51 Ga0207652_10008130 3300025921 Bacteria 8423
52 Ga0207700_10492322 3300025928 Bacteria 1084
53 Ga0207709_10103821 3300025935 Bacteria 1885
54 Ga0207669_10122732 3300025937 Bacteria 1767
55 Ga0207668_10014148 3300025972 Bacteria 4934
56 Ga0207640_12188460 3300025981 Bacteria 502
57 Ga0207678_10271335 3300026067 Bacteria 1455
58 Ga0207648_10292830 3300026089 Bacteria 1458
59 Ga0207675_100050017 3300026118 Bacteria 3900
60 Ga0209389_1000028 3300027296 Bacteria 140401
61 Ga0209489_100027 3300027361 Bacteria 188074
62 Ga0209700_100022 3300027363 Bacteria 229977
63 Ga0268266_10631258 3300028379 Bacteria 1030
64 Ga0268265_10229930 3300028380 Bacteria 1629
65 Ga0307510_10029393 3300033180 Bacteria 6257
66 Ga0373937_1135938 3300036401 Bacteria 730
67 Ga0395900_1807208 3300037418 Unclassified 522
68 Ga0466968_0121290 3300044735 Bacteria 1183
69 Ga0466959_0048080 3300045049 Bacteria 3136
70 Ga0495592_0558081 3300046454 Bacteria 703
71 Ga0495629_0609447 3300046459 Bacteria 730
72 Ga0495628_0177003 3300046516 Bacteria 1615
73 Ga0495631_0099329 3300046518 Bacteria 1253
74 Ga0495652_0090347 3300046529 Bacteria 2506
75 Ga0495652_0100091 3300046529 Bacteria 2353
76 Ga0495652_0339777 3300046529 Bacteria 1079
77 Ga0495645_0483319 3300046543 Bacteria 777
78 Ga0495667_0168117 3300046559 Bacteria 1409
79 Ga0495667_0212797 3300046559 Bacteria 1235
80 Ga0495656_0347229 3300046615 Bacteria 768
81 Ga0495634_0511814 3300046642 Bacteria 703
82 Ga0495657_0077221 3300046675 Bacteria 2161
83 Ga0495669_0016089 3300046684 Bacteria 3203
84 Ga0495600_0111301 3300046809 Bacteria 1783
85 Ga0495600_0269810 3300046809 Bacteria 1079
86 Ga0495604_0442279 3300047317 Bacteria 850
87 Ga0495672_0357036 3300047320 Bacteria 677
88 Ga0495683_0242232 3300047323 Bacteria 795
89 Ga0495687_091128 3300047443 Bacteria 1167
90 Ga0495675_0205855 3300047444 Bacteria 1196
91 Ga0495686_0079560 3300047472 Bacteria 2004
92 Ga0495602_0073384 3300048088 Bacteria 2913
93 Ga0495602_0228308 3300048088 Bacteria 1400
94 Ga0495602_0702993 3300048088 Bacteria 686
95 Ga0496100_0295242 3300048903 Bacteria 1212
96 Ga0496122_0369172 3300048925 Bacteria 741
97 Ga0496123_0066744 3300048926 Bacteria 2277
98 Ga0496126_0026210 3300048929 Bacteria 5594
99 Ga0496126_0058955 3300048929 Bacteria 3459
100 Ga0501046_0565454 3300049580 Unclassified 809
101 Ga0501047_0102111 3300049581 Bacteria 2747
102 Ga0501047_0244506 3300049581 Unclassified 1644
103 Ga0501044_1195081 3300049823 Unclassified 628
104 Ga0495595_0082571 3300053084 Bacteria 1533
105 Ga0495619_0083575 3300053085 Bacteria 2154
106 Ga0500578_0052887 3300053086 Bacteria 2600
107 Ga0500614_001865 3300053123 Bacteria 4872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025917 Ga0207660_10029897 Ga0207660_100298974 101
2 3300005336 Ga0070680_100040726 Ga0070680_1000407263 107
3 3300005458 Ga0070681_10069565 Ga0070681_100695653 107
4 3300005530 Ga0070679_100055501 Ga0070679_1000555015 107
5 3300025912 Ga0207707_10006725 Ga0207707_100067259 107
6 3300025921 Ga0207652_10008130 Ga0207652_1000813014 107
7 3300003794 Ga0055531_10001353 Ga0055531_1000135316 108
8 3300025304 Ga0209257_1000836 Ga0209257_100083629 108
9 3300037418 Ga0395900_1807208 Ga0395900_1807208_47_382 109
10 3300049581 Ga0501047_0102111 Ga0501047_0102111_1130_1510 110
11 iso_pu_bacteria 8056967851 8056975815 112
12 3300049580 Ga0501046_0565454 Ga0501046_0565454_393_761 113
13 3300049581 Ga0501047_0244506 Ga0501047_0244506_633_1001 113
14 iso_pu_bacteria 2906643746 2906649478 113
15 3300025919 Ga0207657_11038614 Ga0207657_110386141 114
16 iso_pu_bacteria 2888419890 2888427440 114
17 3300049823 Ga0501044_1195081 Ga0501044_1195081_37_414 115
18 3300026067 Ga0207678_10271335 Ga0207678_102713353 116
19 3300025261 Ga0209233_1040139 Ga0209233_10401391 117
20 3300010375 Ga0105239_11961492 Ga0105239_119614922 118
21 3300046516 Ga0495628_0177003 Ga0495628_0177003_814_1170 118
22 3300046529 Ga0495652_0339777 Ga0495652_0339777_240_596 118
23 3300047317 Ga0495604_0442279 Ga0495604_0442279_392_748 118
24 3300047472 Ga0495686_0079560 Ga0495686_0079560_44_400 118
25 3300048088 Ga0495602_0228308 Ga0495602_0228308_634_990 118
26 iso_pu_bacteria 2513237161 2514017601 118
27 iso_pu_bacteria 2935616580 2935617964 118
28 iso_pu_bacteria 2935855204 2935856537 118
29 3300009148 Ga0105243_10376060 Ga0105243_103760602 120
30 3300025302 Ga0207426_1001448 Ga0207426_10014489 120
31 iso_pu_bacteria 2874645413 2874649765 120
32 iso_pu_bacteria 2936055302 2936060177 120
33 iso_pu_bacteria 2508501009 2508540869 121
34 iso_pu_bacteria 2513237139 2513877056 121
35 iso_pu_bacteria 2824617872 2824625401 121
36 iso_pu_bacteria 2824626560 2824634189 121
37 iso_pu_bacteria 2824635225 2824641409 121
38 iso_pu_bacteria 2824644064 2824648595 121
39 iso_pu_bacteria 2824714736 2824718471 121
40 iso_pu_bacteria 2824723954 2824728887 121
41 iso_pu_bacteria 2879099564 2879103735 121
42 iso_pu_bacteria 2935777560 2935784689 121
43 iso_pu_bacteria 2935777560 2935784861 121
44 iso_pu_bacteria 2935785616 2935791137 121
45 iso_pu_bacteria 2935785616 2935791583 121
46 iso_pu_bacteria 2935793552 2935799895 121
47 iso_pu_bacteria 2935793552 2935800221 121
48 iso_pu_bacteria 8016522445 8016524287 121
49 iso_pu_bacteria 8016530956 8016537838 121
50 iso_pu_bacteria 8016539877 8016542120 121
51 iso_pu_bacteria 8016548790 8016551163 121
52 iso_pu_bacteria 8016566248 8016567498 121
53 iso_pu_bacteria 8016575299 8016580199 121
54 iso_pu_bacteria 8016583857 8016592036 121
55 iso_pu_bacteria 8016595262 8016597500 121
56 iso_pu_bacteria 8016622563 8016628189 121
57 iso_pu_bacteria 8019530166 8019537512 121
58 iso_pu_bacteria 8019547302 8019555269 121
59 3300005354 Ga0070675_101190012 Ga0070675_1011900121 122
60 3300005364 Ga0070673_100716395 Ga0070673_1007163952 122
61 3300005458 Ga0070681_10431209 Ga0070681_104312092 122
62 3300005841 Ga0068863_100271164 Ga0068863_1002711643 122
63 3300005844 Ga0068862_100430660 Ga0068862_1004306602 122
64 3300005983 Ga0081540_1015945 Ga0081540_10159457 122
65 3300009545 Ga0105237_10267307 Ga0105237_102673072 122
66 3300013105 Ga0157369_10457808 Ga0157369_104578082 122
67 3300025901 Ga0207688_10099295 Ga0207688_100992952 122
68 3300025914 Ga0207671_10704213 Ga0207671_107042132 122
69 3300025928 Ga0207700_10492322 Ga0207700_104923221 122
70 3300025981 Ga0207640_12188460 Ga0207640_121884602 122
71 3300028380 Ga0268265_10229930 Ga0268265_102299303 122
72 3300044735 Ga0466968_0121290 Ga0466968_0121290_649_1044 122
73 3300045049 Ga0466959_0048080 Ga0466959_0048080_490_858 122
74 3300046454 Ga0495592_0558081 Ga0495592_0558081_15_392 122
75 3300046675 Ga0495657_0077221 Ga0495657_0077221_1333_1710 122
76 3300047323 Ga0495683_0242232 Ga0495683_0242232_73_483 122
77 3300047443 Ga0495687_091128 Ga0495687_091128_735_1145 122
78 3300048903 Ga0496100_0295242 Ga0496100_0295242_811_1179 122
79 3300048925 Ga0496122_0369172 Ga0496122_0369172_88_504 122
80 3300048926 Ga0496123_0066744 Ga0496123_0066744_1154_1570 122
81 3300048929 Ga0496126_0026210 Ga0496126_0026210_518_892 122
82 3300048929 Ga0496126_0058955 Ga0496126_0058955_267_638 122
83 3300053086 Ga0500578_0052887 Ga0500578_0052887_769_1179 122
84 iso_pu_bacteria 2936002035 2936008534 122
85 iso_pu_bacteria 8016630954 8016637208 122
86 iso_pu_bacteria 8019659431 8019667798 122
87 3300005339 Ga0070660_100067241 Ga0070660_1000672414 123
88 3300005435 Ga0070714_100848566 Ga0070714_1008485661 123
89 3300046529 Ga0495652_0090347 Ga0495652_0090347_461_841 123
90 3300046543 Ga0495645_0483319 Ga0495645_0483319_257_637 123
91 3300046559 Ga0495667_0168117 Ga0495667_0168117_278_658 123
92 3300046642 Ga0495634_0511814 Ga0495634_0511814_203_583 123
93 3300046809 Ga0495600_0269810 Ga0495600_0269810_667_1047 123
94 3300047320 Ga0495672_0357036 Ga0495672_0357036_220_594 123
95 3300048088 Ga0495602_0073384 Ga0495602_0073384_1729_2109 123
96 3300053084 Ga0495595_0082571 Ga0495595_0082571_1139_1519 123
97 3300006941 Ga0099825_1023048 Ga0099825_10230484 124
98 3300006942 Ga0099824_1012684 Ga0099824_10126844 124
99 3300006944 Ga0099823_1000010 Ga0099823_100001028 124
100 3300027296 Ga0209389_1000028 Ga0209389_1000028113 124
101 3300027361 Ga0209489_100027 Ga0209489_10002781 124
102 3300027363 Ga0209700_100022 Ga0209700_100022114 124
103 3300053123 Ga0500614_001865 Ga0500614_001865_1311_1685 124
104 iso_pu_bacteria 8019668869 8019668879 124
105 3300000546 LJNas_1006654 LJNas_10066542 125
106 3300003354 JGI25160J50197_1000205 JGI25160J50197_100020546 125
107 3300005347 Ga0070668_100022686 Ga0070668_1000226864 125
108 3300005356 Ga0070674_100120386 Ga0070674_1001203862 125
109 3300005438 Ga0070701_10167301 Ga0070701_101673012 125
110 3300005459 Ga0068867_100109288 Ga0068867_1001092882 125
111 3300005547 Ga0070693_101413754 Ga0070693_1014137541 125
112 3300005548 Ga0070665_100641616 Ga0070665_1006416162 125
113 3300005548 Ga0070665_100979707 Ga0070665_1009797072 125
114 3300005614 Ga0068856_100750105 Ga0068856_1007501051 125
115 3300005719 Ga0068861_100049336 Ga0068861_1000493363 125
116 3300006358 Ga0068871_101621126 Ga0068871_1016211261 125
117 3300009553 Ga0105249_10250506 Ga0105249_102505063 125
118 3300013297 Ga0157378_10002726 Ga0157378_1000272612 125
119 3300013306 Ga0163162_10242208 Ga0163162_102422083 125
120 3300013308 Ga0157375_13402120 Ga0157375_134021201 125
121 3300014326 Ga0157380_10023315 Ga0157380_100233153 125
122 3300017792 Ga0163161_10056590 Ga0163161_100565901 125
123 3300017792 Ga0163161_10425089 Ga0163161_104250892 125
124 3300021320 Ga0214544_1001540 Ga0214544_100154029 125
125 3300025302 Ga0207426_1000138 Ga0207426_100013885 125
126 3300025302 Ga0207426_1045896 Ga0207426_10458961 125
127 3300025916 Ga0207663_10024338 Ga0207663_100243383 125
128 3300025935 Ga0207709_10103821 Ga0207709_101038211 125
129 3300025937 Ga0207669_10122732 Ga0207669_101227323 125
130 3300025972 Ga0207668_10014148 Ga0207668_100141485 125
131 3300026089 Ga0207648_10292830 Ga0207648_102928303 125
132 3300026118 Ga0207675_100050017 Ga0207675_1000500173 125
133 3300028379 Ga0268266_10631258 Ga0268266_106312582 125
134 3300033180 Ga0307510_10029393 Ga0307510_100293935 125
135 3300036401 Ga0373937_1135938 Ga0373937_1135938_211_615 125
136 3300046459 Ga0495629_0609447 Ga0495629_0609447_27_404 125
137 3300046518 Ga0495631_0099329 Ga0495631_0099329_148_525 125
138 3300046529 Ga0495652_0100091 Ga0495652_0100091_1088_1492 125
139 3300046559 Ga0495667_0212797 Ga0495667_0212797_184_588 125
140 3300046615 Ga0495656_0347229 Ga0495656_0347229_16_393 125
141 3300046684 Ga0495669_0016089 Ga0495669_0016089_432_809 125
142 3300046809 Ga0495600_0111301 Ga0495600_0111301_960_1364 125
143 3300047444 Ga0495675_0205855 Ga0495675_0205855_183_587 125
144 3300048088 Ga0495602_0702993 Ga0495602_0702993_19_423 125
145 3300053085 Ga0495619_0083575 Ga0495619_0083575_1277_1681 125
146 iso_pu_bacteria 2841974524 2841979707 125

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v6e-assembly1.cif.gz_A crystal structure of usp2 and a mutant form of ubiquitin 0.9307 67 81
5xu8-assembly1.cif.gz_A crystal structure of human usp2 in complex with ubiquitin and 6-thioguanine 0.9306 67 81
3v6c-assembly1.cif.gz_A crystal structure of usp2 in complex with mutated ubiquitin 0.9206 67 81
7ay2-assembly1.cif.gz_B crystal structure of truncated usp1-uaf1 reacted with ubiquitin-prg 0.9185 67 82
7ay2-assembly2.cif.gz_E crystal structure of truncated usp1-uaf1 reacted with ubiquitin-prg 0.8853 67 82
ID Description Score Start End Superfamily
af_A0A1D8PFU3_415_811_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.9366 67 81 3.90.70.10
af_Q9BPP2_137_233_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9324 67 82 2.60.40.10
af_O60139_211_575_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.8946 67 81 3.90.70.10
af_O17963_9_97_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8925 67 82 1.20.1070.10
4dohR02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8632 67 81 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A4V2E8Q4-F1-model_v4 Uncharacterized protein 0.8845 52 125
AF-A0A809ZGE7-F1-model_v4 Uncharacterized protein 0.8782 58 123
AF-A0A2U1WUP0-F1-model_v4 Zinc finger ZPR1-type domain-containing protein 0.8625 58 102
AF-A0A2R4WGI4-F1-model_v4 Uncharacterized protein 0.8583 58 124
AF-A0A0Q6WC25-F1-model_v4 Acyltransferase 0.8486 56 103

Feature Viewer

pLDDT pTM Quality
77.77 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map