F195823

General Info

Members Datasets Scaffolds Average Seq Length
145 112 95 140

Family's Representative Sequence

Representative Sequence 3300049531|Ga0501315_039500|Ga0501315_039500_82_555
Length 157
Sequence LNIKVVIGLFVSKGVKRMYELKTKETDNSVIEFIELLDSPKKREDAYRLLDIFTETTGFEAKMWGPSIIGFGSYHYKYESGHEGDAPLVGFSPRKAKISLYFAPGEPKREELLKQFGKHTTGKACVYINKVADIDVDVLKALINESVSFLQELYPAK

Samples

Sample ID Description Type Environment
1 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
2 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
3 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
4 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
5 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
6 2738541295 Bacillus sp. OK085 Isolate Unclassified
7 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
8 2738543010 Bacillus sp. YR335 Isolate Unclassified
9 2738543017 Bacillus sp. OV186 Isolate Unclassified
10 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
11 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
12 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
13 2818991459 Paenibacillus sp. 597 Isolate Unclassified
14 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
15 2842682962 Bacillus sp. R-72492 Isolate Unclassified
16 2849139964 Bacillus sp. R-71875 Isolate Unclassified
17 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
18 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
19 2857581216 Bacillus sp. R-71922 Isolate Unclassified
20 2857586860 Bacillus sp. R-71935 Isolate Unclassified
21 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
22 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
23 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
24 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
25 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
26 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
27 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
28 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
29 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
30 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
31 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
32 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
33 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
34 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
35 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
36 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
37 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
38 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
39 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
40 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
41 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
42 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
43 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
44 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
45 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
49 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
81 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
86 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
87 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
88 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
97 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
98 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
99 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
100 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
101 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
102 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 8022792930 Bacillus sp. Xin Isolate Rhizosphere
109 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
110 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
111 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
112 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 59.31
Metatranscriptomes 6.21
Isolates 34.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.83
Nodule 0
Rhizoplane 2.76
Rhizosphere 50.34
Stem 0
Stem Tuber 0
Unclassified 22.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1010919 3300002987 Bacteria 2266
2 JGI25159J45721_1040364 3300002987 Bacteria 685
3 JGI25151J46595_10002076 3300003187 Bacteria 12489
4 JGI25151J46595_10004406 3300003187 Bacteria 7457
5 JGI25151J46595_10006670 3300003187 Bacteria 5758
6 JGI25151J46595_10007887 3300003187 Bacteria 5170
7 JGI25151J46595_10027942 3300003187 Bacteria 2253
8 JGI25151J46595_10116574 3300003187 Bacteria 688
9 JGI25151J46595_10142037 3300003187 Bacteria 584
10 Ga0055538_1000371 3300003751 Bacteria 18561
11 Ga0055532_1000619 3300003758 Bacteria 14018
12 Ga0055536_1023062 3300003781 Bacteria 1839
13 Ga0070714_101311281 3300005435 Bacteria 707
14 Ga0070698_100170871 3300005471 Bacteria 2115
15 Ga0070699_100063939 3300005518 Bacteria 3191
16 Ga0075364_10661219 3300006051 Bacteria 713
17 Ga0070715_10116108 3300006163 Bacteria 1269
18 Ga0075430_100032763 3300006846 Bacteria 4410
19 Ga0075430_101264956 3300006846 Bacteria 607
20 Ga0075431_100069182 3300006847 Unclassified 3642
21 Ga0075429_100178549 3300006880 Bacteria 1861
22 Ga0105251_10073433 3300009011 Bacteria 1589
23 Ga0105244_10136320 3300009036 Bacteria 1183
24 Ga0105250_10174897 3300009092 Bacteria 900
25 Ga0114129_10023088 3300009147 Bacteria 8823
26 Ga0114129_11299260 3300009147 Bacteria 902
27 Ga0157371_10205562 3300013102 Bacteria 1412
28 Ga0157371_10224100 3300013102 Unclassified 1350
29 Ga0182006_1005506 3300015261 Bacteria 6023
30 Ga0209784_100092 3300025224 Bacteria 116472
31 Ga0209566_101759 3300025225 Bacteria 5153
32 Ga0209147_100029 3300025229 Bacteria 376498
33 Ga0209130_1004545 3300025284 Bacteria 5218
34 Ga0209130_1023122 3300025284 Bacteria 1375
35 Ga0209130_1031020 3300025284 Bacteria 1099
36 Ga0209130_1050589 3300025284 Bacteria 758
37 Ga0209676_1000598 3300025292 Bacteria 53329
38 Ga0209676_1000768 3300025292 Bacteria 43022
39 Ga0209676_1004637 3300025292 Bacteria 7562
40 Ga0209676_1007536 3300025292 Bacteria 5077
41 Ga0209676_1010726 3300025292 Bacteria 3776
42 Ga0209025_1001343 3300025294 Bacteria 33176
43 Ga0209025_1001356 3300025294 Bacteria 32891
44 Ga0209025_1001387 3300025294 Bacteria 32347
45 Ga0209025_1002505 3300025294 Bacteria 19241
46 Ga0209025_1002884 3300025294 Bacteria 17223
47 Ga0209025_1003610 3300025294 Bacteria 14408
48 Ga0209025_1004016 3300025294 Bacteria 13187
49 Ga0209025_1011600 3300025294 Bacteria 5781
50 Ga0209025_1017419 3300025294 Bacteria 4147
51 Ga0209025_1136999 3300025294 Bacteria 700
52 Ga0207696_1034256 3300025711 Bacteria 1518
53 Ga0209371_1020627 3300027312 Bacteria 1617
54 Ga0268256_1023164 3300030500 Bacteria 1617
55 Ga0307408_100092305 3300031548 Bacteria 2288
56 Ga0307408_100213230 3300031548 Bacteria 1571
57 Ga0307405_11252125 3300031731 Bacteria 644
58 Ga0307406_11546502 3300031901 Bacteria 585
59 Ga0307412_10054629 3300031911 Bacteria 2652
60 Ga0307409_100007253 3300031995 Bacteria 6612
61 Ga0307416_100041071 3300032002 Bacteria 3600
62 Ga0451791_0292495 3300041451 Bacteria 573
63 Ga0451793_1911270 3300041452 Bacteria 604
64 Ga0453684_0117317 3300044712 Unclassified 3221
65 Ga0495609_0372501 3300046538 Bacteria 574
66 Ga0496110_0000373 3300048913 Bacteria 30011
67 Ga0496113_0604183 3300048916 Bacteria 878
68 Ga0496116_0048504 3300048919 Bacteria 2850
69 Ga0496122_0001932 3300048925 Bacteria 31245
70 Ga0496122_0037882 3300048925 Bacteria 3873
71 Ga0496123_0024283 3300048926 Bacteria 4612
72 Ga0496126_0081400 3300048929 Bacteria 2863
73 Ga0501343_001648 3300049132 Bacteria 1530
74 Ga0501305_005313 3300049161 Bacteria 1555
75 Ga0501305_044961 3300049161 Bacteria 727
76 Ga0501312_077661 3300049528 Bacteria 597
77 Ga0501312_080685 3300049528 Bacteria 588
78 Ga0501315_039500 3300049531 Bacteria 709
79 Ga0501315_044487 3300049531 Bacteria 681
80 Ga0501317_030277 3300049533 Bacteria 782
81 Ga0501335_013091 3300049551 Bacteria 826
82 Ga0501198_037647 3300049649 Bacteria 828
83 Ga0501217_091350 3300049661 Bacteria 855
84 Ga0501217_314119 3300049661 Bacteria 520
85 Ga0501233_211538 3300049668 Bacteria 569
86 Ga0501221_200234 3300049704 Bacteria 555
87 Ga0501234_070819 3300049707 Bacteria 602
88 Ga0501266_013784 3300049763 Bacteria 1055
89 Ga0501270_033332 3300049767 Bacteria 862
90 nmdc:mga00v17_565258_c1 3300050491 Bacteria 735
91 nmdc:mga05p37_44639_c1 3300050507 Bacteria 5453
92 nmdc:mga09592_51916_c1 3300050508 Bacteria 3459
93 nmdc:mga0qj67_134970_c1 3300050509 Bacteria 1999
94 nmdc:mga06r32_504121_c1 3300050510 Archaea 1187
95 nmdc:mga06r32_704310_c1 3300050510 Unclassified 975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025292 Ga0209676_1000598 Ga0209676_100059849 131
2 iso_pu_bacteria 2711768088 2712198996 131
3 iso_pu_bacteria 3006973921 3006975012 134
4 iso_pu_bacteria 2788500588 2791213220 135
5 iso_pu_bacteria 2818991451 2819625538 135
6 iso_pu_bacteria 2818991459 2819673429 135
7 iso_pu_bacteria 2904606771 2904608800 135
8 iso_pu_bacteria 2907202186 2907203591 135
9 iso_pu_bacteria 3001272096 3001272673 135
10 iso_pu_bacteria 3006988479 3006989975 135
11 3300041452 Ga0451793_1911270 Ga0451793_1911270_73_483 136
12 iso_pu_bacteria 2554235469 2556063670 136
13 iso_pu_bacteria 2643221543 2643740412 136
14 iso_pu_bacteria 2671180330 2672335725 136
15 iso_pu_bacteria 2703719227 2705994380 136
16 iso_pu_bacteria 2738541295 2738813087 136
17 iso_pu_bacteria 2738541299 2738839819 136
18 iso_pu_bacteria 2738543010 2739234740 136
19 iso_pu_bacteria 2738543017 2739269733 136
20 iso_pu_bacteria 2816332186 2816864924 136
21 iso_pu_bacteria 2821111986 2821115054 136
22 iso_pu_bacteria 2842682962 2842683780 136
23 iso_pu_bacteria 2849139964 2849142332 136
24 iso_pu_bacteria 2852673933 2852675179 136
25 iso_pu_bacteria 2857581216 2857581854 136
26 iso_pu_bacteria 2857586860 2857589415 136
27 iso_pu_bacteria 2857609550 2857612561 136
28 iso_pu_bacteria 2864997549 2864998983 136
29 iso_pu_bacteria 2881636855 2881639051 136
30 iso_pu_bacteria 2881644220 2881649657 136
31 iso_pu_bacteria 2885526491 2885526745 136
32 iso_pu_bacteria 2895498888 2895503823 136
33 iso_pu_bacteria 2904113452 2904118861 136
34 iso_pu_bacteria 2904162308 2904165294 136
35 iso_pu_bacteria 2928510474 2928512373 136
36 iso_pu_bacteria 2956897341 2956897402 136
37 iso_pu_bacteria 2971511577 2971512431 136
38 iso_pu_bacteria 2977254563 2977257602 136
39 iso_pu_bacteria 2980176882 2980178082 136
40 iso_pu_bacteria 3001267043 3001267197 136
41 iso_pu_bacteria 3006826541 3006828560 136
42 iso_pu_bacteria 3006969106 3006971774 136
43 iso_pu_bacteria 3006978542 3006983121 136
44 iso_pu_bacteria 3006984091 3006984952 136
45 iso_pu_bacteria 8022792930 8022795132 136
46 iso_pu_bacteria 8056533031 8056540645 136
47 iso_pu_bacteria 8057582654 8057584956 136
48 iso_pu_bacteria 2857453340 2857454344 137
49 iso_pu_bacteria 2971410472 2971415289 137
50 iso_pu_bacteria 8054280661 8054283175 137
51 iso_pu_bacteria 8057473075 8057477622 137
52 3300013102 Ga0157371_10224100 Ga0157371_102241002 138
53 3300006051 Ga0075364_10661219 Ga0075364_106612191 139
54 3300025294 Ga0209025_1002505 Ga0209025_100250515 139
55 3300041451 Ga0451791_0292495 Ga0451791_0292495_111_530 139
56 3300050491 nmdc:mga00v17_565258_c1 nmdc:mga00v17_565258_c1_76_495 139
57 3300002987 JGI25159J45721_1010919 JGI25159J45721_10109193 140
58 3300002987 JGI25159J45721_1040364 JGI25159J45721_10403641 140
59 3300003187 JGI25151J46595_10002076 JGI25151J46595_100020763 140
60 3300003187 JGI25151J46595_10004406 JGI25151J46595_100044063 140
61 3300003187 JGI25151J46595_10006670 JGI25151J46595_100066706 140
62 3300003187 JGI25151J46595_10007887 JGI25151J46595_100078874 140
63 3300003187 JGI25151J46595_10027942 JGI25151J46595_100279422 140
64 3300003187 JGI25151J46595_10116574 JGI25151J46595_101165741 140
65 3300003187 JGI25151J46595_10142037 JGI25151J46595_101420371 140
66 3300003751 Ga0055538_1000371 Ga0055538_10003717 140
67 3300003758 Ga0055532_1000619 Ga0055532_10006195 140
68 3300003781 Ga0055536_1023062 Ga0055536_10230622 140
69 3300005435 Ga0070714_101311281 Ga0070714_1013112811 140
70 3300005471 Ga0070698_100170871 Ga0070698_1001708712 140
71 3300005518 Ga0070699_100063939 Ga0070699_1000639393 140
72 3300006163 Ga0070715_10116108 Ga0070715_101161081 140
73 3300006846 Ga0075430_100032763 Ga0075430_1000327633 140
74 3300006846 Ga0075430_101264956 Ga0075430_1012649561 140
75 3300006847 Ga0075431_100069182 Ga0075431_1000691824 140
76 3300006880 Ga0075429_100178549 Ga0075429_1001785492 140
77 3300009011 Ga0105251_10073433 Ga0105251_100734332 140
78 3300009036 Ga0105244_10136320 Ga0105244_101363202 140
79 3300009092 Ga0105250_10174897 Ga0105250_101748972 140
80 3300009147 Ga0114129_10023088 Ga0114129_100230885 140
81 3300009147 Ga0114129_11299260 Ga0114129_112992602 140
82 3300013102 Ga0157371_10205562 Ga0157371_102055622 140
83 3300015261 Ga0182006_1005506 Ga0182006_10055062 140
84 3300025224 Ga0209784_100092 Ga0209784_100092110 140
85 3300025225 Ga0209566_101759 Ga0209566_1017597 140
86 3300025229 Ga0209147_100029 Ga0209147_100029130 140
87 3300025284 Ga0209130_1004545 Ga0209130_10045452 140
88 3300025284 Ga0209130_1023122 Ga0209130_10231222 140
89 3300025284 Ga0209130_1031020 Ga0209130_10310202 140
90 3300025284 Ga0209130_1050589 Ga0209130_10505891 140
91 3300025292 Ga0209676_1000768 Ga0209676_100076839 140
92 3300025292 Ga0209676_1004637 Ga0209676_10046379 140
93 3300025292 Ga0209676_1007536 Ga0209676_10075365 140
94 3300025292 Ga0209676_1010726 Ga0209676_10107261 140
95 3300025294 Ga0209025_1001343 Ga0209025_100134321 140
96 3300025294 Ga0209025_1001356 Ga0209025_10013563 140
97 3300025294 Ga0209025_1001387 Ga0209025_100138710 140
98 3300025294 Ga0209025_1002884 Ga0209025_100288417 140
99 3300025294 Ga0209025_1003610 Ga0209025_100361012 140
100 3300025294 Ga0209025_1004016 Ga0209025_10040165 140
101 3300025294 Ga0209025_1011600 Ga0209025_10116004 140
102 3300025294 Ga0209025_1017419 Ga0209025_10174191 140
103 3300025294 Ga0209025_1136999 Ga0209025_11369991 140
104 3300025711 Ga0207696_1034256 Ga0207696_10342561 140
105 3300027312 Ga0209371_1020627 Ga0209371_10206272 140
106 3300030500 Ga0268256_1023164 Ga0268256_10231642 140
107 3300031548 Ga0307408_100092305 Ga0307408_1000923054 140
108 3300031548 Ga0307408_100213230 Ga0307408_1002132303 140
109 3300031731 Ga0307405_11252125 Ga0307405_112521251 140
110 3300031901 Ga0307406_11546502 Ga0307406_115465021 140
111 3300031911 Ga0307412_10054629 Ga0307412_100546294 140
112 3300031995 Ga0307409_100007253 Ga0307409_1000072532 140
113 3300032002 Ga0307416_100041071 Ga0307416_1000410714 140
114 3300044712 Ga0453684_0117317 Ga0453684_0117317_1068_1514 140
115 3300046538 Ga0495609_0372501 Ga0495609_0372501_93_515 140
116 3300048913 Ga0496110_0000373 Ga0496110_0000373_21535_21978 140
117 3300048916 Ga0496113_0604183 Ga0496113_0604183_374_817 140
118 3300048919 Ga0496116_0048504 Ga0496116_0048504_712_1134 140
119 3300048925 Ga0496122_0001932 Ga0496122_0001932_2568_3002 140
120 3300048925 Ga0496122_0037882 Ga0496122_0037882_3349_3771 140
121 3300048926 Ga0496123_0024283 Ga0496123_0024283_2727_3161 140
122 3300048929 Ga0496126_0081400 Ga0496126_0081400_1468_1902 140
123 3300049132 Ga0501343_001648 Ga0501343_001648_131_553 140
124 3300049161 Ga0501305_005313 Ga0501305_005313_981_1403 140
125 3300049161 Ga0501305_044961 Ga0501305_044961_223_645 140
126 3300049528 Ga0501312_077661 Ga0501312_077661_43_471 140
127 3300049528 Ga0501312_080685 Ga0501312_080685_25_447 140
128 3300049531 Ga0501315_039500 Ga0501315_039500_82_555 140
129 3300049531 Ga0501315_044487 Ga0501315_044487_67_495 140
130 3300049533 Ga0501317_030277 Ga0501317_030277_199_630 140
131 3300049551 Ga0501335_013091 Ga0501335_013091_98_520 140
132 3300049649 Ga0501198_037647 Ga0501198_037647_62_484 140
133 3300049661 Ga0501217_091350 Ga0501217_091350_240_662 140
134 3300049661 Ga0501217_314119 Ga0501217_314119_73_501 140
135 3300049668 Ga0501233_211538 Ga0501233_211538_71_493 140
136 3300049704 Ga0501221_200234 Ga0501221_200234_37_510 140
137 3300049707 Ga0501234_070819 Ga0501234_070819_65_487 140
138 3300049763 Ga0501266_013784 Ga0501266_013784_88_519 140
139 3300049767 Ga0501270_033332 Ga0501270_033332_47_469 140
140 3300050507 nmdc:mga05p37_44639_c1 nmdc:mga05p37_44639_c1_1435_1872 140
141 3300050508 nmdc:mga09592_51916_c1 nmdc:mga09592_51916_c1_66_503 140
142 3300050509 nmdc:mga0qj67_134970_c1 nmdc:mga0qj67_134970_c1_888_1325 140
143 3300050510 nmdc:mga06r32_504121_c1 nmdc:mga06r32_504121_c1_237_674 140
144 3300050510 nmdc:mga06r32_704310_c1 nmdc:mga06r32_704310_c1_28_477 140
145 iso_pu_bacteria 2990275345 2990278578 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

42

147

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7598 15 132
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6983 15 132
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6395 15 132
4rf8-assembly1.cif.gz_A crystal structure of double-domain arginine kinase from anthopleura japonicas in complex with adp 0.5832 80 136
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.565 15 132
ID Description Score Start End Superfamily
1i07A00 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.6377 55 70 2.30.30.40
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6179 15 132 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.5628 15 132 3.90.1150.200
af_Q0J314_1_71_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5547 80 131 3.30.70.100
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.5491 30 139 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A2N5GXG1-F1-model_v4 YdhG-like domain-containing protein 0.9948 1 139
AF-A0A261QE04-F1-model_v4 YdhG-like domain-containing protein 0.9915 1 140
AF-A0A1I1LA66-F1-model_v4 YdhG-like domain-containing protein 0.9906 1 137
AF-A0A5P0YIR1-F1-model_v4 deleted 0.9894 1 140
AF-A0A5C5SHM7-F1-model_v4 DUF1801 domain-containing protein 0.989 1 140

Feature Viewer

pLDDT pTM Quality
93.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map