F194646

General Info

Members Datasets Scaffolds Average Seq Length
145 111 290 136

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_11538064|Ga0157373_115380641
Length 134
Sequence MARYVIDAGTLLHLLDHDLPLDPDHQLVAPNGIRSEALQLLLDDVALGLRDEKSALALHERMTELKIRLLGDRVSRGNAWKIARKSGISIRDAEYLAVTRLQADALVTIDESLARTAAGIVPLAPLDALSSAEG

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
58 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
59 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
60 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
61 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
62 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
105 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
107 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
108 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
109 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.72
Nodule 0
Rhizoplane 4.83
Rhizosphere 82.07
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_11538064 3300013100 Bacteria 508
2 Ga0070658_10007287 3300005327 Bacteria 8930
3 Ga0070683_100258250 3300005329 Bacteria 1657
4 Ga0070680_101225812 3300005336 Bacteria 649
5 Ga0070660_100498691 3300005339 Bacteria 1013
6 Ga0070687_101447062 3300005343 Bacteria 515
7 Ga0070714_100315928 3300005435 Bacteria 1460
8 Ga0070713_100362213 3300005436 Unclassified 1347
9 Ga0070713_100782946 3300005436 Bacteria 914
10 Ga0070708_101465288 3300005445 Bacteria 636
11 Ga0070698_101657080 3300005471 Bacteria 592
12 Ga0070679_100010324 3300005530 Bacteria 8853
13 Ga0070679_100110977 3300005530 Bacteria 2729
14 Ga0070684_100054757 3300005535 Bacteria 3476
15 Ga0070684_100063768 3300005535 Bacteria 3231
16 Ga0068853_100747902 3300005539 Bacteria 934
17 Ga0070664_100951617 3300005564 Bacteria 806
18 Ga0068856_100803803 3300005614 Bacteria 960
19 Ga0068859_100404417 3300005617 Bacteria 1461
20 Ga0068866_10857034 3300005718 Bacteria 636
21 Ga0081538_10000019 3300005981 Bacteria 141612
22 Ga0070717_10147146 3300006028 Unclassified 2035
23 Ga0075365_10006080 3300006038 Bacteria 6594
24 Ga0075365_10571722 3300006038 Bacteria 799
25 Ga0075364_10052137 3300006051 Bacteria 2673
26 Ga0075364_10143297 3300006051 Bacteria 1608
27 Ga0075433_10184746 3300006852 Bacteria 1855
28 Ga0075434_100003787 3300006871 Bacteria 13517
29 Ga0075436_100099589 3300006914 Bacteria 2023
30 Ga0097620_100404426 3300006931 Bacteria 1461
31 Ga0075435_100109471 3300007076 Bacteria 2296
32 Ga0111539_10042173 3300009094 Bacteria 5483
33 Ga0105243_12275629 3300009148 Bacteria 579
34 Ga0105248_10294792 3300009177 Bacteria 1826
35 Ga0105249_10500727 3300009553 Bacteria 1260
36 Ga0105246_11960402 3300011119 Bacteria 564
37 Ga0157370_10679147 3300013104 Bacteria 940
38 Ga0157378_10673328 3300013297 Bacteria 1052
39 Ga0157372_10229184 3300013307 Bacteria 2154
40 Ga0157372_10254983 3300013307 Bacteria 2037
41 Ga0163163_10650392 3300014325 Bacteria 1118
42 Ga0182005_1090676 3300015265 Bacteria 850
43 Ga0163161_11315164 3300017792 Bacteria 629
44 Ga0207705_10048639 3300025909 Bacteria 3050
45 Ga0207707_10354006 3300025912 Bacteria 1265
46 Ga0207652_10088501 3300025921 Bacteria 2717
47 Ga0207652_10142316 3300025921 Bacteria 2145
48 Ga0207652_11240276 3300025921 Unclassified 648
49 Ga0207700_10732905 3300025928 Bacteria 883
50 Ga0207664_10000525 3300025929 Bacteria 27231
51 Ga0207664_10305812 3300025929 Bacteria 1400
52 Ga0207664_11191962 3300025929 Unclassified 679
53 Ga0207690_11187607 3300025932 Bacteria 637
54 Ga0207665_10135723 3300025939 Bacteria 1750
55 Ga0207661_10384767 3300025944 Bacteria 1270
56 Ga0207661_11113323 3300025944 Bacteria 727
57 Ga0207679_10663104 3300025945 Bacteria 944
58 Ga0207679_11965736 3300025945 Archaea 533
59 Ga0207712_10742810 3300025961 Bacteria 859
60 Ga0209813_10010824 3300027866 Bacteria 2370
61 Ga0207428_10058326 3300027907 Bacteria 3064
62 Ga0265760_10110749 3300031090 Bacteria 874
63 Ga0307509_10619216 3300031507 Bacteria 754
64 Ga0316576_10038228 3300031727 Bacteria 3440
65 Ga0307406_10177470 3300031901 Bacteria 1548
66 Ga0307409_101567684 3300031995 Bacteria 686
67 Ga0316574_0020668 3300035398 Bacteria 3898
68 Ga0395901_1817215 3300038443 Unclassified 558
69 Ga0439466_0176101 3300041411 Bacteria 652
70 Ga0451841_1042011 3300041498 Bacteria 523
71 Ga0439432_194627 3300042006 Bacteria 588
72 Ga0439449_0054411 3300042007 Bacteria 1478
73 Ga0439460_0015276 3300042461 Bacteria 2030
74 Ga0466969_0002348 3300044656 Bacteria 10111
75 Ga0466965_0193095 3300044683 Bacteria 1078
76 Ga0466965_0433031 3300044683 Bacteria 730
77 Ga0466966_0026723 3300044684 Bacteria 3767
78 Ga0466966_0853056 3300044684 Bacteria 549
79 Ga0466961_0107281 3300044693 Bacteria 1758
80 Ga0466961_0225452 3300044693 Bacteria 1154
81 Ga0466961_0838695 3300044693 Bacteria 548
82 Ga0466963_0377878 3300044694 Bacteria 998
83 Ga0466963_0757924 3300044694 Bacteria 685
84 Ga0466963_0959441 3300044694 Bacteria 602
85 Ga0466964_0297410 3300044706 Bacteria 812
86 Ga0466971_0046231 3300044719 Bacteria 1956
87 Ga0466971_0056299 3300044719 Bacteria 1773
88 Ga0466968_0104514 3300044735 Bacteria 1268
89 Ga0466970_0231105 3300044765 Bacteria 1033
90 Ga0466970_0834246 3300044765 Bacteria 541
91 Ga0466957_0063787 3300044842 Bacteria 2265
92 Ga0466957_0271919 3300044842 Bacteria 1132
93 Ga0466960_0162633 3300044901 Bacteria 1199
94 Ga0466960_0769070 3300044901 Bacteria 581
95 Ga0466959_0179462 3300045049 Bacteria 1482
96 Ga0466959_0203288 3300045049 Bacteria 1378
97 Ga0466959_0643376 3300045049 Bacteria 712
98 Ga0466958_0078454 3300045836 Bacteria 2029
99 Ga0466958_0283171 3300045836 Bacteria 1063
100 Ga0466958_0469695 3300045836 Bacteria 815
101 Ga0466967_0110959 3300045976 Bacteria 2520
102 Ga0466967_0364522 3300045976 Bacteria 1400
103 Ga0495582_0684653 3300046473 Bacteria 593
104 Ga0495628_0500409 3300046516 Bacteria 878
105 Ga0495652_0499230 3300046529 Bacteria 844
106 Ga0495658_0607508 3300046683 Bacteria 701
107 Ga0495675_0466028 3300047444 Bacteria 729
108 Ga0496100_0020450 3300048903 Bacteria 3969
109 Ga0496101_0037032 3300048904 Bacteria 3459
110 Ga0496102_0002428 3300048905 Bacteria 15883
111 Ga0496103_0024676 3300048906 Bacteria 3629
112 Ga0496107_0186657 3300048910 Bacteria 1540
113 Ga0496108_1763642 3300048911 Bacteria 508
114 Ga0496114_0101095 3300048917 Unclassified 2461
115 Ga0501031_0839043 3300049568 Bacteria 589
116 Ga0501034_0390974 3300049571 Bacteria 1315
117 Ga0501036_0552251 3300049572 Bacteria 957
118 Ga0501036_1033329 3300049572 Bacteria 672
119 Ga0501037_0035382 3300049573 Bacteria 3683
120 Ga0501038_0074379 3300049574 Bacteria 2874
121 Ga0501048_0597456 3300049582 Bacteria 792
122 Ga0501071_0214693 3300049587 Bacteria 1447
123 Ga0501076_0269958 3300049592 Bacteria 1393
124 Ga0501081_0729682 3300049743 Bacteria 744
125 nmdc:mga03n38_602876_c1 3300050490 Bacteria 626
126 nmdc:mga00v17_23479_c1 3300050491 Bacteria 3567
127 nmdc:mga00v17_277560_c1 3300050491 Bacteria 1088
128 nmdc:mga0yw44_1717_c1 3300050492 Bacteria 8886
129 nmdc:mga0yw44_264609_c1 3300050492 Bacteria 1147
130 nmdc:mga0yw44_949249_c1 3300050492 Unclassified 583
131 nmdc:mga0yw44_96065_c1 3300050492 Bacteria 1881
132 nmdc:mga04h51_28410_c1 3300050495 Bacteria 1745
133 nmdc:mga07m45_806569_c1 3300050496 Bacteria 538
134 nmdc:mga08y16_27175_c1 3300050511 Bacteria 6030
135 nmdc:mga0n895_10765_c1 3300050512 Bacteria 8110
136 nmdc:mga0n895_981971_c1 3300050512 Unclassified 826
137 nmdc:mga0rr50_440406_c1 3300050513 Bacteria 1104
138 nmdc:mga08x19_22707_c1 3300050514 Bacteria 3886
139 nmdc:mga0a205_58579_c1 3300050515 Bacteria 3720
140 Ga0500573_0398729 3300053140 Bacteria 652
141 Ga0500590_010436 3300053148 Bacteria 4693
142 Ga0500620_000430 3300053155 Bacteria 7619
143 Ga0501084_0477878 3300054114 Bacteria 1053
144 Ga0466962_0009507 3300061719 Bacteria 4662
145 Ga0466962_0029763 3300061719 Bacteria 2614
146 Ga0157373_11538064
147 Ga0070658_10007287
148 Ga0070683_100258250
149 Ga0070680_101225812
150 Ga0070660_100498691
151 Ga0070687_101447062
152 Ga0070714_100315928
153 Ga0070713_100362213
154 Ga0070713_100782946
155 Ga0070708_101465288
156 Ga0070698_101657080
157 Ga0070679_100010324
158 Ga0070679_100110977
159 Ga0070684_100054757
160 Ga0070684_100063768
161 Ga0068853_100747902
162 Ga0070664_100951617
163 Ga0068856_100803803
164 Ga0068859_100404417
165 Ga0068866_10857034
166 Ga0081538_10000019
167 Ga0070717_10147146
168 Ga0075365_10006080
169 Ga0075365_10571722
170 Ga0075364_10052137
171 Ga0075364_10143297
172 Ga0075433_10184746
173 Ga0075434_100003787
174 Ga0075436_100099589
175 Ga0097620_100404426
176 Ga0075435_100109471
177 Ga0111539_10042173
178 Ga0105243_12275629
179 Ga0105248_10294792
180 Ga0105249_10500727
181 Ga0105246_11960402
182 Ga0157370_10679147
183 Ga0157378_10673328
184 Ga0157372_10229184
185 Ga0157372_10254983
186 Ga0163163_10650392
187 Ga0182005_1090676
188 Ga0163161_11315164
189 Ga0207705_10048639
190 Ga0207707_10354006
191 Ga0207652_10088501
192 Ga0207652_10142316
193 Ga0207652_11240276
194 Ga0207700_10732905
195 Ga0207664_10000525
196 Ga0207664_10305812
197 Ga0207664_11191962
198 Ga0207690_11187607
199 Ga0207665_10135723
200 Ga0207661_10384767
201 Ga0207661_11113323
202 Ga0207679_10663104
203 Ga0207679_11965736
204 Ga0207712_10742810
205 Ga0209813_10010824
206 Ga0207428_10058326
207 Ga0265760_10110749
208 Ga0307509_10619216
209 Ga0316576_10038228
210 Ga0307406_10177470
211 Ga0307409_101567684
212 Ga0316574_0020668
213 Ga0395901_1817215
214 Ga0439466_0176101
215 Ga0451841_1042011
216 Ga0439432_194627
217 Ga0439449_0054411
218 Ga0439460_0015276
219 Ga0466969_0002348
220 Ga0466965_0193095
221 Ga0466965_0433031
222 Ga0466966_0026723
223 Ga0466966_0853056
224 Ga0466961_0107281
225 Ga0466961_0225452
226 Ga0466961_0838695
227 Ga0466963_0377878
228 Ga0466963_0757924
229 Ga0466963_0959441
230 Ga0466964_0297410
231 Ga0466971_0046231
232 Ga0466971_0056299
233 Ga0466968_0104514
234 Ga0466970_0231105
235 Ga0466970_0834246
236 Ga0466957_0063787
237 Ga0466957_0271919
238 Ga0466960_0162633
239 Ga0466960_0769070
240 Ga0466959_0179462
241 Ga0466959_0203288
242 Ga0466959_0643376
243 Ga0466958_0078454
244 Ga0466958_0283171
245 Ga0466958_0469695
246 Ga0466967_0110959
247 Ga0466967_0364522
248 Ga0495582_0684653
249 Ga0495628_0500409
250 Ga0495652_0499230
251 Ga0495658_0607508
252 Ga0495675_0466028
253 Ga0496100_0020450
254 Ga0496101_0037032
255 Ga0496102_0002428
256 Ga0496103_0024676
257 Ga0496107_0186657
258 Ga0496108_1763642
259 Ga0496114_0101095
260 Ga0501031_0839043
261 Ga0501034_0390974
262 Ga0501036_0552251
263 Ga0501036_1033329
264 Ga0501037_0035382
265 Ga0501038_0074379
266 Ga0501048_0597456
267 Ga0501071_0214693
268 Ga0501076_0269958
269 Ga0501081_0729682
270 nmdc:mga03n38_602876_c1
271 nmdc:mga00v17_23479_c1
272 nmdc:mga00v17_277560_c1
273 nmdc:mga0yw44_1717_c1
274 nmdc:mga0yw44_264609_c1
275 nmdc:mga0yw44_949249_c1
276 nmdc:mga0yw44_96065_c1
277 nmdc:mga04h51_28410_c1
278 nmdc:mga07m45_806569_c1
279 nmdc:mga08y16_27175_c1
280 nmdc:mga0n895_10765_c1
281 nmdc:mga0n895_981971_c1
282 nmdc:mga0rr50_440406_c1
283 nmdc:mga08x19_22707_c1
284 nmdc:mga0a205_58579_c1
285 Ga0500573_0398729
286 Ga0500590_010436
287 Ga0500620_000430
288 Ga0501084_0477878
289 Ga0466962_0009507
290 Ga0466962_0029763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oq4-assembly1.cif.gz_Q cryo-em structure of the atv rnap inhibitory protein (rip) bound to the dna-binding channel of the host's rna polymerase 0.835 34 64
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.8289 3 122
1wqf-assembly1.cif.gz_A crystal structure of ribosome recycling factor from mycobacterium tuberculosis 0.8221 33 64
4kb2-assembly1.cif.gz_A crystal structure of ribosome recycling factor mutant r109a from mycobacterium tuberculosis 0.8188 33 64
4kaw-assembly1.cif.gz_X crystal structure of ribosome recycling factor mutant r39g from mycobacterium tuberculosis 0.8052 33 64
ID Description Score Start End Superfamily
af_Q2G0N5_664_798_1.10.132.30 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;RNA polymerase Rpb1 funnel domain 0.8945 34 58 1.10.132.30
af_Q9LFQ3_128_200_1.20.1160.11 Mainly Alpha;Up-down Bundle;Paired amphipathic helix 2 (pah2 repeat);Paired amphipathic helix 0.8389 31 64 1.20.1160.11
af_P9WFB7_11_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8349 4 116 3.40.50.1010
af_P9WFA3_1_120_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8313 4 116 3.40.50.1010
2fe1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8289 3 122 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1I2EHF7-F1-model_v4 PIN domain-containing protein 0.9911 6 130
AF-A0A6J4K7L8-F1-model_v4 PIN domain-containing protein 0.9902 1 135
AF-A0A4Q7YCU1-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.989 1 132
AF-A0A3N4ZB05-F1-model_v4 Nucleic acid-binding protein 0.987 1 133
AF-A0A7W0PLI4-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9854 1 116

Map