F194548

General Info

Members Datasets Scaffolds Average Seq Length
145 92 142 280

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10840160|Ga0114129_108401602
Length 297
Sequence MLGNRHGHEEVEETMAEVSKAVLITGCSTGIGRATAERLAAGGWTVYATARRPESIEDLQAKGCKTLALDVTDEASMRAAVDHVETAEGAVGVLVNNAGYSQSGAVESVNLDDVRAQFETNVFGLVRMCQLALPGMRAQGWGKIVNVSSMGGKMTFPGGGIYHGTKHAVEAISDAMRFEVRGFGVDVIVIEPGLIRTQFGEAAVNSIQSGTSGNGPYAKFNAAVAEATAGVYDGPLAKLGGGPDTVARKIEKAISSRRPRTRYPVTPSARMIMGIHTVLPDRGWDAFNASNFPRPKP

Samples

Sample ID Description Type Environment
1 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
2 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
3 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
31 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
38 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
42 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
55 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
56 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
57 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
70 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
71 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
75 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
78 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
84 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
85 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
91 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
92 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 0
Isolates 2.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.14
Nodule 0
Rhizoplane 3.45
Rhizosphere 88.97
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000100 3300003373 Bacteria 11811
2 JGI25407J50210_10014096 3300003373 Bacteria 2059
3 Ga0055540_1000147 3300003792 Bacteria 70743
4 Ga0068869_100135464 3300005334 Bacteria 1897
5 Ga0070714_100055146 3300005435 Bacteria 3397
6 Ga0070713_100448083 3300005436 Bacteria 1212
7 Ga0068856_100506277 3300005614 Bacteria 1228
8 Ga0068852_100224744 3300005616 Unclassified 1787
9 Ga0081455_10009787 3300005937 Bacteria 9816
10 Ga0081455_10068102 3300005937 Bacteria 2964
11 Ga0081455_10092391 3300005937 Bacteria 2448
12 Ga0081455_10122651 3300005937 Bacteria 2045
13 Ga0081538_10002078 3300005981 Bacteria 19943
14 Ga0081538_10013299 3300005981 Bacteria 6525
15 Ga0081538_10072089 3300005981 Bacteria 1896
16 Ga0081538_10088970 3300005981 Bacteria 1605
17 Ga0081539_10004213 3300005985 Bacteria 16213
18 Ga0070717_10005524 3300006028 Bacteria 9221
19 Ga0075365_10082915 3300006038 Bacteria 2175
20 Ga0075364_10072303 3300006051 Bacteria 2273
21 Ga0075428_100003432 3300006844 Bacteria 17345
22 Ga0075428_100004800 3300006844 Bacteria 14991
23 Ga0075428_100452088 3300006844 Bacteria 1376
24 Ga0075430_100010627 3300006846 Bacteria 7800
25 Ga0075430_100022119 3300006846 Bacteria 5405
26 Ga0075431_100015388 3300006847 Bacteria 7751
27 Ga0075431_100247768 3300006847 Bacteria 1811
28 Ga0075433_10008931 3300006852 Bacteria 8001
29 Ga0075434_100001960 3300006871 Bacteria 17843
30 Ga0075429_100151944 3300006880 Bacteria 2027
31 Ga0075435_100208475 3300007076 Bacteria 1657
32 Ga0111539_10003876 3300009094 Bacteria 19693
33 Ga0105245_10148936 3300009098 Bacteria 2211
34 Ga0114129_10017768 3300009147 Bacteria 10127
35 Ga0114129_10025129 3300009147 Bacteria 8442
36 Ga0114129_10030563 3300009147 Bacteria 7621
37 Ga0114129_10417233 3300009147 Bacteria 1766
38 Ga0114129_10507695 3300009147 Bacteria 1574
39 Ga0114129_10840160 3300009147 Bacteria 1168
40 Ga0105243_10038719 3300009148 Bacteria 3714
41 Ga0105249_10072688 3300009553 Bacteria 3180
42 Ga0213876_10008519 3300021384 Bacteria 5551
43 Ga0213876_10088938 3300021384 Bacteria 1636
44 Ga0213875_10024828 3300021388 Bacteria 2857
45 Ga0209051_1000333 3300025303 Bacteria 70796
46 Ga0207646_10355832 3300025922 Unclassified 1323
47 Ga0207700_10045249 3300025928 Bacteria 3246
48 Ga0207700_10546296 3300025928 Bacteria 1028
49 Ga0207664_10022025 3300025929 Bacteria 4750
50 Ga0207664_10118996 3300025929 Bacteria 2208
51 Ga0207664_10352536 3300025929 Bacteria 1303
52 Ga0265319_1001275 3300028563 Bacteria 15284
53 Ga0265320_10026392 3300031240 Bacteria 3041
54 Ga0265340_10008337 3300031247 Bacteria 5599
55 Ga0265331_10025391 3300031250 Bacteria 2992
56 Ga0265327_10051623 3300031251 Bacteria 2146
57 Ga0265316_10034416 3300031344 Bacteria 4115
58 Ga0265314_10010587 3300031711 Bacteria 7676
59 Ga0265342_10008406 3300031712 Bacteria 7401
60 Ga0307410_10053153 3300031852 Bacteria 2740
61 Ga0307410_10307315 3300031852 Bacteria 1253
62 Ga0307406_10191748 3300031901 Bacteria 1497
63 Ga0307407_10064561 3300031903 Bacteria 2152
64 Ga0307409_100097243 3300031995 Bacteria 2431
65 Ga0307409_100322845 3300031995 Bacteria 1446
66 Ga0307409_100416557 3300031995 Bacteria 1287
67 Ga0307416_100460510 3300032002 Bacteria 1327
68 Ga0307411_10195335 3300032005 Bacteria 1549
69 Ga0307415_100038824 3300032126 Bacteria 3141
70 Ga0307415_100182927 3300032126 Bacteria 1646
71 Ga0395899_0219112 3300037312 Bacteria 1319
72 Ga0395898_0063174 3300037466 Bacteria 3594
73 Ga0395898_0170892 3300037466 Bacteria 2078
74 Ga0436364_1032211 3300037853 Bacteria 8190
75 Ga0395901_0069419 3300038443 Bacteria 3670
76 Ga0395901_0214960 3300038443 Bacteria 2011
77 Ga0395901_0611624 3300038443 Bacteria 1098
78 Ga0436365_0379030 3300039437 Bacteria 13964
79 Ga0439448_0003559 3300042005 Bacteria 4327
80 Ga0466969_0029582 3300044656 Bacteria 2796
81 Ga0466972_0057288 3300044658 Bacteria 1872
82 Ga0466972_0181105 3300044658 Bacteria 988
83 Ga0466965_0027565 3300044683 Bacteria 2758
84 Ga0466966_0053158 3300044684 Bacteria 2570
85 Ga0466966_0194897 3300044684 Bacteria 1227
86 Ga0466961_0006291 3300044693 Bacteria 7540
87 Ga0466961_0059885 3300044693 Bacteria 2421
88 Ga0466961_0071933 3300044693 Bacteria 2194
89 Ga0466961_0223446 3300044693 Bacteria 1160
90 Ga0466963_0000372 3300044694 Bacteria 20412
91 Ga0466963_0008556 3300044694 Bacteria 6141
92 Ga0466963_0048720 3300044694 Bacteria 2801
93 Ga0466963_0082491 3300044694 Bacteria 2180
94 Ga0466971_0043839 3300044719 Bacteria 2010
95 Ga0466968_0026475 3300044735 Bacteria 2381
96 Ga0466970_0054278 3300044765 Bacteria 2140
97 Ga0466957_0015911 3300044842 Bacteria 4397
98 Ga0466957_0017168 3300044842 Bacteria 4237
99 Ga0466957_0174179 3300044842 Bacteria 1403
100 Ga0466959_0074641 3300045049 Bacteria 2452
101 Ga0466959_0078971 3300045049 Bacteria 2373
102 Ga0466959_0154216 3300045049 Bacteria 1617
103 Ga0466958_0002372 3300045836 Bacteria 9426
104 Ga0466958_0008901 3300045836 Bacteria 5576
105 Ga0466967_0011323 3300045976 Bacteria 6747
106 Ga0466967_0015411 3300045976 Bacteria 5990
107 Ga0466967_0016652 3300045976 Bacteria 5805
108 Ga0466967_0038264 3300045976 Bacteria 4112
109 Ga0466967_0045811 3300045976 Bacteria 3803
110 Ga0466967_0048780 3300045976 Bacteria 3700
111 Ga0466967_0426203 3300045976 Bacteria 1294
112 Ga0495641_0035891 3300046461 Bacteria 2333
113 Ga0495605_0070149 3300046474 Bacteria 1658
114 Ga0495664_0211769 3300046477 Bacteria 1174
115 Ga0495652_0145066 3300046529 Bacteria 1862
116 Ga0496102_0382239 3300048905 Bacteria 1325
117 Ga0496106_0338109 3300048909 Bacteria 1209
118 Ga0496107_0041035 3300048910 Bacteria 3323
119 Ga0496109_0266700 3300048912 Bacteria 1613
120 Ga0496113_0312027 3300048916 Bacteria 1260
121 Ga0501031_0115498 3300049568 Bacteria 1754
122 Ga0501072_0115452 3300049588 Bacteria 2138
123 Ga0501072_0148629 3300049588 Bacteria 1868
124 Ga0501073_0131198 3300049589 Bacteria 1737
125 Ga0501077_0187083 3300049593 Bacteria 1316
126 Ga0501044_0090925 3300049823 Bacteria 3079
127 nmdc:mga00v17_145828_c1 3300050491 Bacteria 1519
128 nmdc:mga0yw44_35983_c2 3300050492 Bacteria 1741
129 nmdc:mga05p37_10710_c1 3300050507 Bacteria 10884
130 nmdc:mga05p37_179668_c1 3300050507 Bacteria 1819
131 nmdc:mga05p37_262476_c1 3300050507 Bacteria 2066
132 nmdc:mga05p37_646458_c1 3300050507 Bacteria 1185
133 nmdc:mga0qj67_30184_c1 3300050509 Bacteria 4216
134 nmdc:mga06r32_119974_c1 3300050510 Bacteria 2593
135 nmdc:mga06r32_78256_c1 3300050510 Bacteria 3214
136 nmdc:mga08y16_276862_c1 3300050511 Bacteria 1134
137 nmdc:mga08y16_33471_c1 3300050511 Bacteria 5397
138 nmdc:mga0n895_8395_c1 3300050512 Bacteria 8944
139 nmdc:mga0a205_10857_c1 3300050515 Bacteria 8378
140 Ga0501082_0269126 3300060353 Bacteria 1483
141 Ga0466962_0017182 3300061719 Bacteria 3486
142 Ga0466962_0019818 3300061719 Bacteria 3232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048916 Ga0496113_0312027 Ga0496113_0312027_119_907 248
2 3300009094 Ga0111539_10003876 Ga0111539_100038766 249
3 3300037853 Ga0436364_1032211 Ga0436364_1032211_1445_2215 249
4 3300050511 nmdc:mga08y16_33471_c1 nmdc:mga08y16_33471_c1_708_1556 249
5 3300005616 Ga0068852_100224744 Ga0068852_1002247442 256
6 3300048909 Ga0496106_0338109 Ga0496106_0338109_280_1128 256
7 3300050507 nmdc:mga05p37_646458_c1 nmdc:mga05p37_646458_c1_384_1169 258
8 3300006852 Ga0075433_10008931 Ga0075433_100089314 260
9 3300006871 Ga0075434_100001960 Ga0075434_10000196012 260
10 3300007076 Ga0075435_100208475 Ga0075435_1002084752 260
11 3300009147 Ga0114129_10017768 Ga0114129_100177685 260
12 3300050507 nmdc:mga05p37_10710_c1 nmdc:mga05p37_10710_c1_5378_6241 260
13 3300050512 nmdc:mga0n895_8395_c1 nmdc:mga0n895_8395_c1_2556_3419 260
14 3300050515 nmdc:mga0a205_10857_c1 nmdc:mga0a205_10857_c1_3266_4129 260
15 3300005937 Ga0081455_10122651 Ga0081455_101226512 261
16 3300005981 Ga0081538_10072089 Ga0081538_100720893 262
17 3300006051 Ga0075364_10072303 Ga0075364_100723032 265
18 3300031852 Ga0307410_10307315 Ga0307410_103073152 265
19 3300031995 Ga0307409_100097243 Ga0307409_1000972432 265
20 3300032126 Ga0307415_100038824 Ga0307415_1000388242 265
21 3300050491 nmdc:mga00v17_145828_c1 nmdc:mga00v17_145828_c1_477_1334 265
22 3300006038 Ga0075365_10082915 Ga0075365_100829152 267
23 3300044735 Ga0466968_0026475 Ga0466968_0026475_1555_2361 267
24 3300031901 Ga0307406_10191748 Ga0307406_101917482 268
25 3300032002 Ga0307416_100460510 Ga0307416_1004605102 268
26 3300032005 Ga0307411_10195335 Ga0307411_101953352 268
27 3300031852 Ga0307410_10053153 Ga0307410_100531532 272
28 3300031995 Ga0307409_100416557 Ga0307409_1004165572 272
29 3300032126 Ga0307415_100182927 Ga0307415_1001829272 272
30 3300044765 Ga0466970_0054278 Ga0466970_0054278_192_1016 272
31 3300009098 Ga0105245_10148936 Ga0105245_101489362 273
32 3300009148 Ga0105243_10038719 Ga0105243_100387194 273
33 iso_pu_bacteria 2956939328 2956940049 273
34 iso_pu_bacteria 3001119090 3001121462 273
35 3300031903 Ga0307407_10064561 Ga0307407_100645612 274
36 3300049588 Ga0501072_0115452 Ga0501072_0115452_155_991 274
37 3300005334 Ga0068869_100135464 Ga0068869_1001354642 275
38 3300046474 Ga0495605_0070149 Ga0495605_0070149_311_1141 275
39 iso_pu_bacteria 2744054611 2744954037 275
40 3300003792 Ga0055540_1000147 Ga0055540_100014716 276
41 3300005937 Ga0081455_10009787 Ga0081455_100097878 276
42 3300009147 Ga0114129_10025129 Ga0114129_100251291 276
43 3300009553 Ga0105249_10072688 Ga0105249_100726881 276
44 3300025303 Ga0209051_1000333 Ga0209051_100033316 276
45 3300037466 Ga0395898_0063174 Ga0395898_0063174_1651_2499 276
46 3300038443 Ga0395901_0214960 Ga0395901_0214960_762_1610 276
47 3300042005 Ga0439448_0003559 Ga0439448_0003559_3074_3913 276
48 3300044658 Ga0466972_0057288 Ga0466972_0057288_859_1698 276
49 3300045976 Ga0466967_0048780 Ga0466967_0048780_11_850 276
50 3300049823 Ga0501044_0090925 Ga0501044_0090925_928_1767 276
51 3300050492 nmdc:mga0yw44_35983_c2 nmdc:mga0yw44_35983_c2_222_1067 276
52 3300005435 Ga0070714_100055146 Ga0070714_1000551463 277
53 3300005436 Ga0070713_100448083 Ga0070713_1004480832 277
54 3300005937 Ga0081455_10068102 Ga0081455_100681023 277
55 3300005937 Ga0081455_10092391 Ga0081455_100923913 277
56 3300006028 Ga0070717_10005524 Ga0070717_100055246 277
57 3300006844 Ga0075428_100452088 Ga0075428_1004520881 277
58 3300006846 Ga0075430_100022119 Ga0075430_1000221193 277
59 3300006847 Ga0075431_100015388 Ga0075431_1000153884 277
60 3300006880 Ga0075429_100151944 Ga0075429_1001519442 277
61 3300009147 Ga0114129_10030563 Ga0114129_100305638 277
62 3300009147 Ga0114129_10417233 Ga0114129_104172333 277
63 3300009147 Ga0114129_10840160 Ga0114129_108401602 277
64 3300021384 Ga0213876_10088938 Ga0213876_100889382 277
65 3300021388 Ga0213875_10024828 Ga0213875_100248282 277
66 3300025928 Ga0207700_10045249 Ga0207700_100452494 277
67 3300025928 Ga0207700_10546296 Ga0207700_105462962 277
68 3300025929 Ga0207664_10022025 Ga0207664_100220252 277
69 3300025929 Ga0207664_10118996 Ga0207664_101189962 277
70 3300025929 Ga0207664_10352536 Ga0207664_103525361 277
71 3300031995 Ga0307409_100322845 Ga0307409_1003228452 277
72 3300037312 Ga0395899_0219112 Ga0395899_0219112_59_913 277
73 3300037466 Ga0395898_0170892 Ga0395898_0170892_50_904 277
74 3300038443 Ga0395901_0069419 Ga0395901_0069419_1455_2309 277
75 3300038443 Ga0395901_0611624 Ga0395901_0611624_190_1044 277
76 3300044658 Ga0466972_0181105 Ga0466972_0181105_17_871 277
77 3300044683 Ga0466965_0027565 Ga0466965_0027565_177_1019 277
78 3300044693 Ga0466961_0006291 Ga0466961_0006291_5232_6077 277
79 3300044693 Ga0466961_0059885 Ga0466961_0059885_406_1248 277
80 3300044693 Ga0466961_0071933 Ga0466961_0071933_342_1184 277
81 3300044694 Ga0466963_0000372 Ga0466963_0000372_10083_10925 277
82 3300044694 Ga0466963_0008556 Ga0466963_0008556_583_1425 277
83 3300044694 Ga0466963_0048720 Ga0466963_0048720_819_1682 277
84 3300044694 Ga0466963_0082491 Ga0466963_0082491_516_1361 277
85 3300044719 Ga0466971_0043839 Ga0466971_0043839_392_1234 277
86 3300044842 Ga0466957_0015911 Ga0466957_0015911_377_1219 277
87 3300044842 Ga0466957_0017168 Ga0466957_0017168_1242_2084 277
88 3300044842 Ga0466957_0174179 Ga0466957_0174179_134_979 277
89 3300045049 Ga0466959_0078971 Ga0466959_0078971_405_1250 277
90 3300045049 Ga0466959_0154216 Ga0466959_0154216_410_1252 277
91 3300045836 Ga0466958_0002372 Ga0466958_0002372_4939_5781 277
92 3300045836 Ga0466958_0008901 Ga0466958_0008901_1977_2819 277
93 3300045976 Ga0466967_0011323 Ga0466967_0011323_1793_2638 277
94 3300045976 Ga0466967_0015411 Ga0466967_0015411_4454_5296 277
95 3300045976 Ga0466967_0016652 Ga0466967_0016652_1144_1989 277
96 3300045976 Ga0466967_0038264 Ga0466967_0038264_1967_2809 277
97 3300045976 Ga0466967_0426203 Ga0466967_0426203_189_1040 277
98 3300046477 Ga0495664_0211769 Ga0495664_0211769_175_1020 277
99 3300046529 Ga0495652_0145066 Ga0495652_0145066_290_1135 277
100 3300048905 Ga0496102_0382239 Ga0496102_0382239_10_864 277
101 3300048910 Ga0496107_0041035 Ga0496107_0041035_662_1516 277
102 3300048912 Ga0496109_0266700 Ga0496109_0266700_61_915 277
103 3300049588 Ga0501072_0148629 Ga0501072_0148629_996_1838 277
104 3300050507 nmdc:mga05p37_179668_c1 nmdc:mga05p37_179668_c1_455_1306 277
105 3300050511 nmdc:mga08y16_276862_c1 nmdc:mga08y16_276862_c1_134_985 277
106 3300061719 Ga0466962_0017182 Ga0466962_0017182_244_1089 277
107 3300061719 Ga0466962_0019818 Ga0466962_0019818_1434_2276 277
108 3300003373 JGI25407J50210_10000100 JGI25407J50210_1000010012 278
109 3300003373 JGI25407J50210_10014096 JGI25407J50210_100140963 278
110 3300005614 Ga0068856_100506277 Ga0068856_1005062771 278
111 3300005981 Ga0081538_10002078 Ga0081538_1000207814 278
112 3300005981 Ga0081538_10013299 Ga0081538_100132994 278
113 3300005981 Ga0081538_10088970 Ga0081538_100889702 278
114 3300005985 Ga0081539_10004213 Ga0081539_1000421312 278
115 3300006844 Ga0075428_100003432 Ga0075428_10000343212 278
116 3300006844 Ga0075428_100004800 Ga0075428_1000048002 278
117 3300006846 Ga0075430_100010627 Ga0075430_1000106274 278
118 3300006847 Ga0075431_100247768 Ga0075431_1002477682 278
119 3300009147 Ga0114129_10507695 Ga0114129_105076952 278
120 3300021384 Ga0213876_10008519 Ga0213876_100085192 278
121 3300025922 Ga0207646_10355832 Ga0207646_103558321 278
122 3300028563 Ga0265319_1001275 Ga0265319_100127514 278
123 3300031240 Ga0265320_10026392 Ga0265320_100263924 278
124 3300031247 Ga0265340_10008337 Ga0265340_100083374 278
125 3300031250 Ga0265331_10025391 Ga0265331_100253913 278
126 3300031251 Ga0265327_10051623 Ga0265327_100516232 278
127 3300031344 Ga0265316_10034416 Ga0265316_100344164 278
128 3300031711 Ga0265314_10010587 Ga0265314_100105874 278
129 3300031712 Ga0265342_10008406 Ga0265342_100084062 278
130 3300039437 Ga0436365_0379030 Ga0436365_0379030_7450_8292 278
131 3300044656 Ga0466969_0029582 Ga0466969_0029582_1384_2229 278
132 3300044684 Ga0466966_0053158 Ga0466966_0053158_350_1195 278
133 3300044684 Ga0466966_0194897 Ga0466966_0194897_140_988 278
134 3300044693 Ga0466961_0223446 Ga0466961_0223446_128_973 278
135 3300045049 Ga0466959_0074641 Ga0466959_0074641_1223_2062 278
136 3300045976 Ga0466967_0045811 Ga0466967_0045811_2598_3440 278
137 3300046461 Ga0495641_0035891 Ga0495641_0035891_870_1730 278
138 3300049568 Ga0501031_0115498 Ga0501031_0115498_331_1188 278
139 3300049589 Ga0501073_0131198 Ga0501073_0131198_182_1048 278
140 3300049593 Ga0501077_0187083 Ga0501077_0187083_348_1205 278
141 3300050507 nmdc:mga05p37_262476_c1 nmdc:mga05p37_262476_c1_674_1531 278
142 3300050509 nmdc:mga0qj67_30184_c1 nmdc:mga0qj67_30184_c1_1481_2353 278
143 3300050510 nmdc:mga06r32_119974_c1 nmdc:mga06r32_119974_c1_94_981 278
144 3300050510 nmdc:mga06r32_78256_c1 nmdc:mga06r32_78256_c1_512_1384 278
145 3300060353 Ga0501082_0269126 Ga0501082_0269126_38_895 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

20

207

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

26

227

0.94

PF08659

KR

KR domain

20

196

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

22

179

0.75

PF13460

NAD_binding_10

NAD(P)H-binding

26

234

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bgl-assembly1.cif.gz_A x-ray structure of binary-secoisolariciresinol dehydrogenase 0.9363 3 177
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9362 3 245
6zzo-assembly1.cif.gz_B crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.9336 1 183
3rkr-assembly1.cif.gz_A-2 crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with nadp 0.9315 2 176
3v2h-assembly1.cif.gz_B the crystal structure of d-beta-hydroxybutyrate dehydrogenase from sinorhizobium meliloti 0.9304 1 177
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9705 82 176 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9462 4 174 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9393 1 176 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9374 3 183 3.40.50.720
2bglA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9363 3 177 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537ZK75-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.992 3 134 GO:0016491
AF-A0A7W1CW45-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9873 1 176 GO:0016491
AF-A0A2S3U8W8-F1-model_v4 Putative short-chain type dehydrogenase/reductase VdlC (EC 1.-.-.-) 0.9796 3 184 GO:0016491
AF-A0A256K4W7-F1-model_v4 deleted 0.9775 3 174
AF-A0A162Q3B8-F1-model_v4 Uncharacterized protein 0.9753 3 185 GO:0005783
GO:0016491

Feature Viewer

pLDDT pTM Quality
89.23 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map