F193933

General Info

Members Datasets Scaffolds Average Seq Length
145 106 290 164

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100248489|Ga0070711_1002484892
Length 178
Sequence VFWDNVGVNRDACPEPIRIFVTGGTFDKEYDELTGQLYFKDSHLPEMLKLGRCNLRLEVRTLMMIDSLDMTDADRNLILEQCRQAPETRIVITHGTDTMVVTAQALAANIKDKTIVLTGAMVPYKFGSSDGLFNLGSALAFAQALPPGVYLAMNGRVFRANRVLKNRQTGMFEEQPAS

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
77 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
103 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
104 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.83
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100248489 3300005439 Unclassified 1394
2 Ga0065712_10153590 3300005290 Bacteria 1349
3 Ga0065715_10369944 3300005293 Bacteria 885
4 Ga0070670_100075550 3300005331 Bacteria 2895
5 Ga0070670_100174933 3300005331 Bacteria 1863
6 Ga0070668_100273586 3300005347 Unclassified 1408
7 Ga0070669_100210610 3300005353 Bacteria 1533
8 Ga0070669_100651741 3300005353 Bacteria 886
9 Ga0070675_100169039 3300005354 Bacteria 1884
10 Ga0070675_100455645 3300005354 Bacteria 1148
11 Ga0070673_100836311 3300005364 Bacteria 851
12 Ga0070700_101098030 3300005441 Bacteria 659
13 Ga0070708_100035993 3300005445 Bacteria 4316
14 Ga0070678_101676194 3300005456 Unclassified 598
15 Ga0070698_100002876 3300005471 Bacteria 18945
16 Ga0070698_100484402 3300005471 Unclassified 1174
17 Ga0070699_100135431 3300005518 Bacteria 2173
18 Ga0070679_100115552 3300005530 Bacteria 2669
19 Ga0070672_100448021 3300005543 Bacteria 1112
20 Ga0070672_100856991 3300005543 Bacteria 801
21 Ga0070695_100229162 3300005545 Bacteria 1342
22 Ga0068854_100997712 3300005578 Unclassified 741
23 Ga0068859_100162967 3300005617 Bacteria 2309
24 Ga0068864_100169003 3300005618 Bacteria 1993
25 Ga0068864_100267538 3300005618 Bacteria 1592
26 Ga0068870_10017213 3300005840 Bacteria 3469
27 Ga0068863_100028206 3300005841 Bacteria 5359
28 Ga0068862_100318119 3300005844 Unclassified 1436
29 Ga0068862_100342842 3300005844 Bacteria 1384
30 Ga0070717_10059889 3300006028 Bacteria 3152
31 Ga0097621_100474044 3300006237 Bacteria 1130
32 Ga0097621_100478557 3300006237 Bacteria 1125
33 Ga0068871_100004612 3300006358 Bacteria 9621
34 Ga0075428_100002506 3300006844 Bacteria 19942
35 Ga0075428_100012747 3300006844 Bacteria 9347
36 Ga0075428_100053570 3300006844 Bacteria 4421
37 Ga0075428_100112357 3300006844 Bacteria 2967
38 Ga0075430_100004857 3300006846 Bacteria 11311
39 Ga0075430_100169693 3300006846 Bacteria 1815
40 Ga0075431_100001894 3300006847 Bacteria 19841
41 Ga0075431_100244721 3300006847 Bacteria 1823
42 Ga0075429_100000924 3300006880 Bacteria 23283
43 Ga0075429_100616700 3300006880 Bacteria 950
44 Ga0075436_100001276 3300006914 Bacteria 17103
45 Ga0075436_100022191 3300006914 Bacteria 4360
46 Ga0097620_100162966 3300006931 Bacteria 2309
47 Ga0111539_10018803 3300009094 Bacteria 8549
48 Ga0105247_10601639 3300009101 Bacteria 815
49 Ga0105242_10043346 3300009176 Bacteria 3639
50 Ga0157378_10002845 3300013297 Bacteria 15428
51 Ga0157378_10322547 3300013297 Bacteria 1501
52 Ga0157378_10525373 3300013297 Bacteria 1185
53 Ga0163162_11550149 3300013306 Unclassified 755
54 Ga0157380_10257098 3300014326 Bacteria 1584
55 Ga0157380_11087629 3300014326 Bacteria 838
56 Ga0157377_10740856 3300014745 Bacteria 718
57 Ga0163161_10979375 3300017792 Unclassified 721
58 Ga0163161_11109849 3300017792 Bacteria 680
59 Ga0213875_10202119 3300021388 Bacteria 935
60 Ga0207699_10623934 3300025906 Bacteria 786
61 Ga0207684_10716642 3300025910 Bacteria 849
62 Ga0207663_10206834 3300025916 Unclassified 1420
63 Ga0207652_10130521 3300025921 Bacteria 2241
64 Ga0207681_10048499 3300025923 Bacteria 2867
65 Ga0207650_10138696 3300025925 Bacteria 1910
66 Ga0207650_10145250 3300025925 Bacteria 1868
67 Ga0207650_10206459 3300025925 Bacteria 1576
68 Ga0207650_10746580 3300025925 Bacteria 828
69 Ga0207659_10233201 3300025926 Unclassified 1485
70 Ga0207659_10448210 3300025926 Bacteria 1087
71 Ga0207659_11241785 3300025926 Bacteria 640
72 Ga0207691_10052525 3300025940 Bacteria 3722
73 Ga0207691_10373818 3300025940 Unclassified 1217
74 Ga0207691_10406909 3300025940 Bacteria 1160
75 Ga0207679_10493385 3300025945 Bacteria 1092
76 Ga0207651_11079137 3300025960 Bacteria 719
77 Ga0207658_10853439 3300025986 Bacteria 828
78 Ga0207676_10239426 3300026095 Bacteria 1627
79 Ga0207675_101921993 3300026118 Unclassified 610
80 Ga0207683_10014565 3300026121 Bacteria 6698
81 Ga0207428_10000750 3300027907 Bacteria 37156
82 Ga0268265_11140016 3300028380 Unclassified 775
83 Ga0265338_10039227 3300028800 Bacteria 4473
84 Ga0265320_10101930 3300031240 Bacteria 1321
85 Ga0265316_10006280 3300031344 Bacteria 11383
86 Ga0265314_10062326 3300031711 Bacteria 2535
87 Ga0307409_100583019 3300031995 Bacteria 1103
88 Ga0307411_10721892 3300032005 Bacteria 870
89 Ga0373936_0477993 3300035113 Bacteria 578
90 Ga0316574_0436498 3300035398 Bacteria 822
91 Ga0316574_0575885 3300035398 Bacteria 697
92 Ga0395905_0011991 3300037471 Bacteria 8360
93 Ga0436360_0784983 3300039438 Bacteria 2697
94 Ga0436363_1536540 3300039450 Bacteria 721
95 Ga0451853_4123237 3300041512 Bacteria 1733
96 Ga0451577_0262967 3300042876 Bacteria 1562
97 Ga0451577_0747246 3300042876 Bacteria 885
98 Ga0453684_0019109 3300044712 Bacteria 10458
99 Ga0453684_0023485 3300044712 Bacteria 9075
100 Ga0453684_0828593 3300044712 Bacteria 996
101 Ga0451576_0082260 3300045051 Bacteria 3348
102 Ga0451576_1658362 3300045051 Bacteria 663
103 Ga0466967_0135022 3300045976 Bacteria 2294
104 Ga0495618_0643486 3300046514 Bacteria 628
105 Ga0495658_0075086 3300046683 Bacteria 1972
106 Ga0495613_0417952 3300046689 Bacteria 913
107 Ga0496100_0003788 3300048903 Bacteria 7918
108 Ga0496101_0014885 3300048904 Bacteria 5235
109 Ga0496102_0040715 3300048905 Bacteria 4205
110 Ga0496104_1506613 3300048907 Bacteria 575
111 Ga0496105_0089952 3300048908 Bacteria 2536
112 Ga0496107_0006919 3300048910 Bacteria 7815
113 Ga0496114_0000226 3300048917 Bacteria 40968
114 Ga0501032_0210152 3300049569 Bacteria 1269
115 Ga0501033_0636939 3300049570 Bacteria 729
116 Ga0501036_0025996 3300049572 Bacteria 4940
117 Ga0501037_0808106 3300049573 Bacteria 619
118 Ga0501039_0256844 3300049575 Bacteria 1374
119 Ga0501041_0016434 3300049577 Bacteria 4399
120 Ga0501042_0236232 3300049578 Bacteria 1319
121 Ga0501071_0017886 3300049587 Bacteria 4900
122 Ga0501072_0025682 3300049588 Bacteria 4589
123 Ga0501074_0596903 3300049590 Bacteria 781
124 Ga0501075_0175183 3300049591 Bacteria 1637
125 Ga0501076_0022183 3300049592 Bacteria 4879
126 Ga0501076_0174708 3300049592 Bacteria 1751
127 Ga0501076_0265519 3300049592 Bacteria 1405
128 Ga0501077_0133040 3300049593 Bacteria 1577
129 Ga0501079_0155901 3300049741 Bacteria 1780
130 Ga0501083_0601071 3300049744 Bacteria 716
131 nmdc:mga09592_471_c1 3300050508 Bacteria 30134
132 nmdc:mga09592_588967_c1 3300050508 Bacteria 954
133 nmdc:mga0qj67_359_c1 3300050509 Bacteria 31536
134 nmdc:mga0qj67_660086_c1 3300050509 Bacteria 834
135 nmdc:mga06r32_130496_c2 3300050510 Bacteria 2079
136 nmdc:mga06r32_1304_c1 3300050510 Bacteria 22502
137 nmdc:mga08y16_1557758_c1 3300050511 Bacteria 620
138 nmdc:mga08y16_32876_c1 3300050511 Bacteria 5453
139 nmdc:mga08y16_954709_c1 3300050511 Bacteria 840
140 nmdc:mga08x19_2570_c1 3300050514 Bacteria 11035
141 nmdc:mga08x19_40488_c1 3300050514 Bacteria 2965
142 Ga0495595_0104077 3300053084 Bacteria 1372
143 Ga0495619_0305270 3300053085 Bacteria 1102
144 Ga0501082_0759363 3300060353 Bacteria 849
145 Ga0530510_0613931 3300061734 Bacteria 827
146 Ga0070711_100248489
147 Ga0065712_10153590
148 Ga0065715_10369944
149 Ga0070670_100075550
150 Ga0070670_100174933
151 Ga0070668_100273586
152 Ga0070669_100210610
153 Ga0070669_100651741
154 Ga0070675_100169039
155 Ga0070675_100455645
156 Ga0070673_100836311
157 Ga0070700_101098030
158 Ga0070708_100035993
159 Ga0070678_101676194
160 Ga0070698_100002876
161 Ga0070698_100484402
162 Ga0070699_100135431
163 Ga0070679_100115552
164 Ga0070672_100448021
165 Ga0070672_100856991
166 Ga0070695_100229162
167 Ga0068854_100997712
168 Ga0068859_100162967
169 Ga0068864_100169003
170 Ga0068864_100267538
171 Ga0068870_10017213
172 Ga0068863_100028206
173 Ga0068862_100318119
174 Ga0068862_100342842
175 Ga0070717_10059889
176 Ga0097621_100474044
177 Ga0097621_100478557
178 Ga0068871_100004612
179 Ga0075428_100002506
180 Ga0075428_100012747
181 Ga0075428_100053570
182 Ga0075428_100112357
183 Ga0075430_100004857
184 Ga0075430_100169693
185 Ga0075431_100001894
186 Ga0075431_100244721
187 Ga0075429_100000924
188 Ga0075429_100616700
189 Ga0075436_100001276
190 Ga0075436_100022191
191 Ga0097620_100162966
192 Ga0111539_10018803
193 Ga0105247_10601639
194 Ga0105242_10043346
195 Ga0157378_10002845
196 Ga0157378_10322547
197 Ga0157378_10525373
198 Ga0163162_11550149
199 Ga0157380_10257098
200 Ga0157380_11087629
201 Ga0157377_10740856
202 Ga0163161_10979375
203 Ga0163161_11109849
204 Ga0213875_10202119
205 Ga0207699_10623934
206 Ga0207684_10716642
207 Ga0207663_10206834
208 Ga0207652_10130521
209 Ga0207681_10048499
210 Ga0207650_10138696
211 Ga0207650_10145250
212 Ga0207650_10206459
213 Ga0207650_10746580
214 Ga0207659_10233201
215 Ga0207659_10448210
216 Ga0207659_11241785
217 Ga0207691_10052525
218 Ga0207691_10373818
219 Ga0207691_10406909
220 Ga0207679_10493385
221 Ga0207651_11079137
222 Ga0207658_10853439
223 Ga0207676_10239426
224 Ga0207675_101921993
225 Ga0207683_10014565
226 Ga0207428_10000750
227 Ga0268265_11140016
228 Ga0265338_10039227
229 Ga0265320_10101930
230 Ga0265316_10006280
231 Ga0265314_10062326
232 Ga0307409_100583019
233 Ga0307411_10721892
234 Ga0373936_0477993
235 Ga0316574_0436498
236 Ga0316574_0575885
237 Ga0395905_0011991
238 Ga0436360_0784983
239 Ga0436363_1536540
240 Ga0451853_4123237
241 Ga0451577_0262967
242 Ga0451577_0747246
243 Ga0453684_0019109
244 Ga0453684_0023485
245 Ga0453684_0828593
246 Ga0451576_0082260
247 Ga0451576_1658362
248 Ga0466967_0135022
249 Ga0495618_0643486
250 Ga0495658_0075086
251 Ga0495613_0417952
252 Ga0496100_0003788
253 Ga0496101_0014885
254 Ga0496102_0040715
255 Ga0496104_1506613
256 Ga0496105_0089952
257 Ga0496107_0006919
258 Ga0496114_0000226
259 Ga0501032_0210152
260 Ga0501033_0636939
261 Ga0501036_0025996
262 Ga0501037_0808106
263 Ga0501039_0256844
264 Ga0501041_0016434
265 Ga0501042_0236232
266 Ga0501071_0017886
267 Ga0501072_0025682
268 Ga0501074_0596903
269 Ga0501075_0175183
270 Ga0501076_0022183
271 Ga0501076_0174708
272 Ga0501076_0265519
273 Ga0501077_0133040
274 Ga0501079_0155901
275 Ga0501083_0601071
276 nmdc:mga09592_471_c1
277 nmdc:mga09592_588967_c1
278 nmdc:mga0qj67_359_c1
279 nmdc:mga0qj67_660086_c1
280 nmdc:mga06r32_130496_c2
281 nmdc:mga06r32_1304_c1
282 nmdc:mga08y16_1557758_c1
283 nmdc:mga08y16_32876_c1
284 nmdc:mga08y16_954709_c1
285 nmdc:mga08x19_2570_c1
286 nmdc:mga08x19_40488_c1
287 Ga0495595_0104077
288 Ga0495619_0305270
289 Ga0501082_0759363
290 Ga0530510_0613931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00710

Asparaginase

Asparaginase, N-terminal

16

175

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b74-assembly1.cif.gz_A crystal structure of conjoined pyrococcus furiosus l-asparaginase with peptide 0.8854 1 161
1wnf-assembly1.cif.gz_B crystal structure of ph0066 from pyrococcus horikoshii 0.8824 1 161
1wls-assembly1.cif.gz_B crystal structure of l-asparaginase i homologue protein from pyrococcus horikoshii 0.8809 1 161
4q0m-assembly1.cif.gz_A-2 crystal structure of pyrococcus furiosus l-asparaginase 0.8768 1 161
5b74-assembly1.cif.gz_A crystal structure of conjoined pyrococcus furiosus l-asparaginase with peptide 0.8751 1 161
ID Description Score Start End Superfamily
af_A4HWE1_24_232_3.40.50.1170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.884 2 161 3.40.50.1170
1wnfB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8824 1 161 3.40.50.1170
1wnfB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8723 1 161 3.40.50.1170
af_Q2FYF4_1_206_3.40.50.1170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8716 2 160 3.40.50.1170
af_A4HWE1_24_232_3.40.50.1170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8688 2 161 3.40.50.1170
ID Description Score Start End GO Terms
AF-A0A2W4SH29-F1-model_v4 Asparaginase 0.9867 1 161 GO:0004067
AF-A0A1V5GEM8-F1-model_v4 L-asparaginase 1 (EC 3.5.1.1) 0.9855 49 162 GO:0004067
AF-A0A7C4IW10-F1-model_v4 Asparaginase 0.9838 1 162 GO:0004067
AF-A0A4Q7MFP0-F1-model_v4 L-asparaginase 0.9823 1 162 GO:0004067
GO:0016020
AF-A0A6S6TC90-F1-model_v4 L-asparaginase (EC) (EC 3.5.1.1) 0.981 1 161 GO:0004067

Map