F193475

General Info

Members Datasets Scaffolds Average Seq Length
145 105 128 227

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1010651|Ga0055536_10106512
Length 269
Sequence MRKLNFTKHFGLISLPAQKQTLFTRKFSISSPIIPSEMSIELVVFDMAGTTVKDKNFVGIAFQEAMRSQGYEIAIENVNPLMGYEKPLAIKMMLEVRESDKSKITAELVDTIHTHFVNGMIGFYQTTTEIAPLPHVEETFSALREQGIKIALNTGFSRDIADVIVSRLGWGNKIDCLVASDEVPYGRPYPDMIRKIMTELGIASAERIAKVGDTEVDINEGINAGCKYVIGVTTGAFTREELLPYKPTHIIDDIAEVPGIISASHEMAV

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
9 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
10 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
11 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
12 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
13 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
14 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
15 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
16 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
72 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
77 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
78 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
89 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
90 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
105 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.28
Metatranscriptomes 0
Isolates 11.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.9
Nodule 0
Rhizoplane 2.07
Rhizosphere 75.86
Stem 0
Stem Tuber 0
Unclassified 15.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10019207 3300001989 Bacteria 2449
2 JGI24739J22299_10019246 3300001989 Bacteria 2447
3 JGI24737J22298_10000283 3300001990 Bacteria 16831
4 JGI24735J21928_10000003 3300002067 Bacteria 385983
5 JGI25157J39369_1004823 3300002741 Bacteria 2339
6 rootH1_10075482 3300003316 Bacteria 4967
7 rootH1_10162732 3300003316 Bacteria 1674
8 rootH2_10002941 3300003320 Bacteria 24596
9 rootH2_10009183 3300003320 Bacteria 5735
10 rootH2_10012319 3300003320 Bacteria 43351
11 rootH2_10019589 3300003320 Bacteria 16881
12 rootH2_10163710 3300003320 Bacteria 1718
13 rootH1_10044609 3300003323 Bacteria 6762
14 rootH1_10051940 3300003323 Bacteria 3404
15 rootH1_10227394 3300003323 Unclassified 1227
16 rootH1_10390208 3300003323 Bacteria 1955
17 JGI25160J50197_1014217 3300003354 Bacteria 2672
18 Ga0055536_1010651 3300003781 Bacteria 3618
19 Ga0065165_1000057 3300005262 Bacteria 185971
20 Ga0065714_10008730 3300005288 Bacteria 4521
21 Ga0065714_10015210 3300005288 Bacteria 2285
22 Ga0065704_10092137 3300005289 Unclassified 2673
23 Ga0070658_10000053 3300005327 Bacteria 116207
24 Ga0070660_100019692 3300005339 Bacteria 4949
25 Ga0070671_100001833 3300005355 Bacteria 16174
26 Ga0068855_100033153 3300005563 Bacteria 6166
27 Ga0068855_100033163 3300005563 Bacteria 6165
28 Ga0068855_100718190 3300005563 Bacteria 1068
29 Ga0068858_100425378 3300005842 Bacteria 1277
30 Ga0068860_100035090 3300005843 Bacteria 4812
31 Ga0075366_10059550 3300006195 Bacteria 2268
32 Ga0097621_100679692 3300006237 Unclassified 946
33 Ga0068871_100017220 3300006358 Bacteria 5464
34 Ga0075429_100018774 3300006880 Bacteria 5989
35 Ga0105240_10080080 3300009093 Unclassified 4018
36 Ga0105240_10119469 3300009093 Unclassified 3175
37 Ga0105240_10167201 3300009093 Unclassified 2608
38 Ga0111539_10121758 3300009094 Bacteria 3057
39 Ga0105241_10338117 3300009174 Bacteria 1304
40 Ga0105241_10355774 3300009174 Bacteria 1273
41 Ga0105237_10002196 3300009545 Bacteria 24433
42 Ga0105237_10006389 3300009545 Bacteria 13079
43 Ga0105237_10011967 3300009545 Bacteria 9169
44 Ga0105238_10116282 3300009551 Unclassified 2654
45 Ga0105238_10226309 3300009551 Bacteria 1847
46 Ga0105249_10007589 3300009553 Bacteria 9466
47 Ga0105239_10000383 3300010375 Bacteria 64504
48 Ga0105239_10005878 3300010375 Bacteria 14299
49 Ga0105239_10091547 3300010375 Bacteria 3356
50 Ga0157373_10004018 3300013100 Bacteria 11091
51 Ga0157371_10136202 3300013102 Bacteria 1749
52 Ga0157370_10005661 3300013104 Bacteria 13968
53 Ga0157370_10303589 3300013104 Bacteria 1473
54 Ga0157370_10741472 3300013104 Bacteria 895
55 Ga0157369_10043165 3300013105 Bacteria 4916
56 Ga0157374_10000011 3300013296 Bacteria 466749
57 Ga0157374_10031429 3300013296 Bacteria 4825
58 Ga0157374_10442080 3300013296 Bacteria 1301
59 Ga0157378_10010743 3300013297 Bacteria 8004
60 Ga0163162_10000731 3300013306 Bacteria 30472
61 Ga0163162_10005559 3300013306 Bacteria 12193
62 Ga0157372_10004452 3300013307 Bacteria 14944
63 Ga0157375_10005507 3300013308 Bacteria 11017
64 Ga0157375_10276926 3300013308 Bacteria 1840
65 Ga0157376_10047973 3300014969 Bacteria 3528
66 Ga0183373_1008 3300015682 Bacteria 255339
67 Ga0209436_101069 3300025208 Bacteria 10358
68 Ga0209026_1000408 3300025250 Bacteria 37522
69 Ga0209130_1000540 3300025284 Bacteria 38066
70 Ga0209676_1000558 3300025292 Bacteria 56412
71 Ga0207426_1000057 3300025302 Bacteria 369548
72 Ga0207705_10000028 3300025909 Bacteria 240636
73 Ga0207654_10264020 3300025911 Bacteria 1159
74 Ga0207695_10209603 3300025913 Bacteria 1860
75 Ga0207695_10222969 3300025913 Unclassified 1792
76 Ga0207671_10008244 3300025914 Bacteria 8865
77 Ga0207671_10020672 3300025914 Bacteria 5007
78 Ga0207671_10113415 3300025914 Unclassified 2065
79 Ga0207694_10042917 3300025924 Bacteria 3490
80 Ga0207667_10032510 3300025949 Bacteria 5620
81 Ga0207667_10063245 3300025949 Bacteria 3867
82 Ga0207712_10082289 3300025961 Unclassified 2346
83 Ga0207703_10516563 3300026035 Bacteria 1123
84 Ga0268264_10005246 3300028381 Bacteria 10966
85 Ga0316183_1023499 3300030742 Bacteria 19568
86 Ga0316181_1034803 3300030744 Bacteria 21356
87 Ga0316181_1243301 3300030744 Bacteria 2267
88 Ga0307414_10002023 3300032004 Bacteria 10537
89 Ga0307510_10011992 3300033180 Bacteria 10274
90 Ga0395899_0000001 3300037312 Bacteria 1750322
91 Ga0439436_0040544 3300041404 Bacteria 1334
92 Ga0451789_0983970 3300041443 Unclassified 1247
93 Ga0439432_100771 3300042006 Bacteria 864
94 Ga0466959_0017184 3300045049 Bacteria 5298
95 Ga0466959_0215905 3300045049 Unclassified 1332
96 Ga0495650_0000023 3300046471 Bacteria 527763
97 Ga0495585_0000801 3300046492 Bacteria 27427
98 Ga0495606_0000654 3300046507 Bacteria 54570
99 Ga0495606_0015768 3300046507 Bacteria 5802
100 Ga0495606_0332241 3300046507 Bacteria 813
101 Ga0495610_0000103 3300046512 Bacteria 98502
102 Ga0495610_0002450 3300046512 Bacteria 15599
103 Ga0495616_0000975 3300046513 Bacteria 20508
104 Ga0495631_0013435 3300046518 Bacteria 3975
105 Ga0495637_0020049 3300046520 Bacteria 3080
106 Ga0495637_0030955 3300046520 Bacteria 2370
107 Ga0495609_0036096 3300046538 Bacteria 2234
108 Ga0495633_0013329 3300046558 Bacteria 4337
109 Ga0495625_0000308 3300046660 Bacteria 74661
110 Ga0495625_0012381 3300046660 Bacteria 6913
111 Ga0495625_0214721 3300046660 Bacteria 1263
112 Ga0495661_0011993 3300046665 Bacteria 5866
113 Ga0495661_0198655 3300046665 Bacteria 1051
114 Ga0495649_0000105 3300046694 Bacteria 74750
115 Ga0495660_0005323 3300046810 Bacteria 7707
116 Ga0495683_0007224 3300047323 Bacteria 6028
117 Ga0495687_000304 3300047443 Bacteria 64746
118 Ga0495679_062311 3300047446 Bacteria 1091
119 Ga0496115_0053887 3300048918 Bacteria 3229
120 Ga0501043_0026787 3300049579 Bacteria 4523
121 Ga0501043_0075679 3300049579 Bacteria 2644
122 Ga0501046_0096683 3300049580 Bacteria 2269
123 Ga0501241_010038 3300049758 Bacteria 1722
124 Ga0501044_0173545 3300049823 Bacteria 2126
125 nmdc:mga0k408_640_c1 3300050493 Bacteria 19275
126 nmdc:mga09592_27813_c1 3300050508 Bacteria 4693
127 nmdc:mga06r32_541423_c1 3300050510 Bacteria 1139
128 Ga0500624_001567 3300053157 Bacteria 3520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047446 Ga0495679_062311 Ga0495679_062311_420_1022 200
2 3300049580 Ga0501046_0096683 Ga0501046_0096683_1625_2239 204
3 3300009093 Ga0105240_10167201 Ga0105240_101672012 208
4 3300025913 Ga0207695_10222969 Ga0207695_102229692 208
5 3300003316 rootH1_10162732 rootH1_101627322 213
6 3300005563 Ga0068855_100033163 Ga0068855_1000331634 214
7 3300006237 Ga0097621_100679692 Ga0097621_1006796921 214
8 3300006358 Ga0068871_100017220 Ga0068871_1000172202 214
9 3300009093 Ga0105240_10080080 Ga0105240_100800803 214
10 3300010375 Ga0105239_10000383 Ga0105239_1000038359 214
11 3300025913 Ga0207695_10209603 Ga0207695_102096031 214
12 3300025914 Ga0207671_10020672 Ga0207671_100206724 214
13 3300025949 Ga0207667_10063245 Ga0207667_100632454 214
14 3300005289 Ga0065704_10092137 Ga0065704_100921373 217
15 3300005288 Ga0065714_10008730 Ga0065714_100087306 218
16 3300050510 nmdc:mga06r32_541423_c1 nmdc:mga06r32_541423_c1_359_1048 218
17 3300002741 JGI25157J39369_1004823 JGI25157J39369_10048232 219
18 3300025250 Ga0209026_1000408 Ga0209026_10004083 219
19 iso_pu_bacteria 2929239360 2929245543 220
20 iso_pu_bacteria 2818991460 2819677807 221
21 iso_pu_bacteria 2842903701 2842907837 221
22 iso_pu_bacteria 2884791551 2884797756 221
23 iso_pu_bacteria 2929177148 2929183193 221
24 iso_pu_bacteria 2945977869 2945979154 221
25 iso_pu_bacteria 2946013367 2946014982 221
26 iso_pu_bacteria 2522125168 2522547829 222
27 iso_pu_bacteria 2857627736 2857631470 223
28 3300006880 Ga0075429_100018774 Ga0075429_1000187742 224
29 3300009551 Ga0105238_10226309 Ga0105238_102263092 224
30 3300009553 Ga0105249_10007589 Ga0105249_100075897 224
31 3300025961 Ga0207712_10082289 Ga0207712_100822893 224
32 3300041443 Ga0451789_0983970 Ga0451789_0983970_151_825 224
33 3300049579 Ga0501043_0026787 Ga0501043_0026787_602_1276 224
34 3300049579 Ga0501043_0075679 Ga0501043_0075679_168_857 224
35 3300049823 Ga0501044_0173545 Ga0501044_0173545_198_872 224
36 3300050508 nmdc:mga09592_27813_c1 nmdc:mga09592_27813_c1_3827_4543 224
37 iso_pu_bacteria 2599185184 2599479432 224
38 iso_pu_bacteria 2852623160 2852626240 224
39 iso_pu_bacteria 2884933994 2884934694 224
40 iso_pu_bacteria 2919437846 2919437971 224
41 iso_pu_bacteria 2928078545 2928082262 224
42 iso_pu_bacteria 2928147474 2928149161 224
43 iso_pu_bacteria 2932082852 2932084977 224
44 iso_pu_bacteria 8055588893 8055591340 224
45 3300003320 rootH2_10019589 rootH2_1001958919 225
46 3300003323 rootH1_10044609 rootH1_100446091 225
47 3300003354 JGI25160J50197_1014217 JGI25160J50197_10142173 225
48 3300025208 Ga0209436_101069 Ga0209436_1010698 225
49 3300025284 Ga0209130_1000540 Ga0209130_100054015 225
50 3300025302 Ga0207426_1000057 Ga0207426_1000057156 225
51 3300030742 Ga0316183_1023499 Ga0316183_10234997 225
52 3300030744 Ga0316181_1034803 Ga0316181_10348035 225
53 3300003781 Ga0055536_1010651 Ga0055536_10106512 226
54 3300005262 Ga0065165_1000057 Ga0065165_1000057111 226
55 3300005288 Ga0065714_10015210 Ga0065714_100152102 226
56 3300009094 Ga0111539_10121758 Ga0111539_101217583 226
57 3300013102 Ga0157371_10136202 Ga0157371_101362022 226
58 3300013104 Ga0157370_10741472 Ga0157370_107414721 226
59 3300015682 Ga0183373_1008 Ga0183373_1008118 226
60 3300025292 Ga0209676_1000558 Ga0209676_100055844 226
61 3300032004 Ga0307414_10002023 Ga0307414_100020232 226
62 3300045049 Ga0466959_0017184 Ga0466959_0017184_256_936 226
63 3300046512 Ga0495610_0000103 Ga0495610_0000103_78780_79460 226
64 3300046520 Ga0495637_0030955 Ga0495637_0030955_106_786 226
65 3300003320 rootH2_10002941 rootH2_1000294115 227
66 3300003323 rootH1_10227394 rootH1_102273942 227
67 3300013104 Ga0157370_10005661 Ga0157370_100056619 227
68 3300013296 Ga0157374_10000011 Ga0157374_1000001127 227
69 3300013306 Ga0163162_10000731 Ga0163162_1000073114 227
70 3300014969 Ga0157376_10047973 Ga0157376_100479734 227
71 3300030744 Ga0316181_1243301 Ga0316181_12433013 227
72 3300041404 Ga0439436_0040544 Ga0439436_0040544_57_743 227
73 3300042006 Ga0439432_100771 Ga0439432_100771_145_831 227
74 3300045049 Ga0466959_0215905 Ga0466959_0215905_274_966 227
75 3300049758 Ga0501241_010038 Ga0501241_010038_415_1101 227
76 3300001989 JGI24739J22299_10019207 JGI24739J22299_100192074 228
77 3300001989 JGI24739J22299_10019246 JGI24739J22299_100192462 228
78 3300001990 JGI24737J22298_10000283 JGI24737J22298_1000028314 228
79 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003299 228
80 3300003316 rootH1_10075482 rootH1_100754823 228
81 3300003320 rootH2_10009183 rootH2_100091832 228
82 3300003320 rootH2_10012319 rootH2_1001231916 228
83 3300003320 rootH2_10163710 rootH2_101637102 228
84 3300003323 rootH1_10051940 rootH1_100519403 228
85 3300003323 rootH1_10390208 rootH1_103902082 228
86 3300005327 Ga0070658_10000053 Ga0070658_1000005340 228
87 3300005339 Ga0070660_100019692 Ga0070660_1000196924 228
88 3300005355 Ga0070671_100001833 Ga0070671_1000018335 228
89 3300005563 Ga0068855_100033153 Ga0068855_1000331534 228
90 3300005563 Ga0068855_100718190 Ga0068855_1007181902 228
91 3300005842 Ga0068858_100425378 Ga0068858_1004253782 228
92 3300005843 Ga0068860_100035090 Ga0068860_1000350902 228
93 3300006195 Ga0075366_10059550 Ga0075366_100595502 228
94 3300009093 Ga0105240_10119469 Ga0105240_101194692 228
95 3300009174 Ga0105241_10338117 Ga0105241_103381172 228
96 3300009174 Ga0105241_10355774 Ga0105241_103557742 228
97 3300009545 Ga0105237_10002196 Ga0105237_1000219615 228
98 3300009545 Ga0105237_10006389 Ga0105237_100063899 228
99 3300009545 Ga0105237_10011967 Ga0105237_100119675 228
100 3300009551 Ga0105238_10116282 Ga0105238_101162822 228
101 3300010375 Ga0105239_10005878 Ga0105239_1000587810 228
102 3300010375 Ga0105239_10091547 Ga0105239_100915473 228
103 3300013100 Ga0157373_10004018 Ga0157373_100040186 228
104 3300013104 Ga0157370_10303589 Ga0157370_103035892 228
105 3300013105 Ga0157369_10043165 Ga0157369_100431654 228
106 3300013296 Ga0157374_10031429 Ga0157374_100314292 228
107 3300013296 Ga0157374_10442080 Ga0157374_104420802 228
108 3300013297 Ga0157378_10010743 Ga0157378_100107435 228
109 3300013306 Ga0163162_10005559 Ga0163162_100055596 228
110 3300013307 Ga0157372_10004452 Ga0157372_100044524 228
111 3300013308 Ga0157375_10005507 Ga0157375_100055072 228
112 3300013308 Ga0157375_10276926 Ga0157375_102769261 228
113 3300025909 Ga0207705_10000028 Ga0207705_10000028169 228
114 3300025911 Ga0207654_10264020 Ga0207654_102640202 228
115 3300025914 Ga0207671_10008244 Ga0207671_100082445 228
116 3300025914 Ga0207671_10113415 Ga0207671_101134152 228
117 3300025924 Ga0207694_10042917 Ga0207694_100429173 228
118 3300025949 Ga0207667_10032510 Ga0207667_100325104 228
119 3300026035 Ga0207703_10516563 Ga0207703_105165631 228
120 3300028381 Ga0268264_10005246 Ga0268264_1000524610 228
121 3300033180 Ga0307510_10011992 Ga0307510_100119924 228
122 3300037312 Ga0395899_0000001 Ga0395899_0000001_751371_752057 228
123 3300046471 Ga0495650_0000023 Ga0495650_0000023_13490_14176 228
124 3300046492 Ga0495585_0000801 Ga0495585_0000801_12649_13335 228
125 3300046507 Ga0495606_0000654 Ga0495606_0000654_14817_15503 228
126 3300046507 Ga0495606_0015768 Ga0495606_0015768_3647_4333 228
127 3300046507 Ga0495606_0332241 Ga0495606_0332241_37_723 228
128 3300046512 Ga0495610_0002450 Ga0495610_0002450_13961_14647 228
129 3300046513 Ga0495616_0000975 Ga0495616_0000975_8303_8989 228
130 3300046518 Ga0495631_0013435 Ga0495631_0013435_3119_3811 228
131 3300046520 Ga0495637_0020049 Ga0495637_0020049_1617_2303 228
132 3300046538 Ga0495609_0036096 Ga0495609_0036096_1344_2030 228
133 3300046558 Ga0495633_0013329 Ga0495633_0013329_647_1333 228
134 3300046660 Ga0495625_0000308 Ga0495625_0000308_60738_61424 228
135 3300046660 Ga0495625_0012381 Ga0495625_0012381_836_1522 228
136 3300046660 Ga0495625_0214721 Ga0495625_0214721_298_984 228
137 3300046665 Ga0495661_0011993 Ga0495661_0011993_5155_5841 228
138 3300046665 Ga0495661_0198655 Ga0495661_0198655_340_1026 228
139 3300046694 Ga0495649_0000105 Ga0495649_0000105_13128_13814 228
140 3300046810 Ga0495660_0005323 Ga0495660_0005323_1618_2304 228
141 3300047323 Ga0495683_0007224 Ga0495683_0007224_5251_5937 228
142 3300047443 Ga0495687_000304 Ga0495687_000304_52183_52869 228
143 3300048918 Ga0496115_0053887 Ga0496115_0053887_910_1611 228
144 3300050493 nmdc:mga0k408_640_c1 nmdc:mga0k408_640_c1_2770_3456 228
145 3300053157 Ga0500624_001567 Ga0500624_001567_333_1019 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

184

257

0.94

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

43

231

0.89

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

40

225

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.9207 1 227
3s6j-assembly3.cif.gz_D the crystal structure of a hydrolase from pseudomonas syringae 0.9151 4 227
3s6j-assembly2.cif.gz_B the crystal structure of a hydrolase from pseudomonas syringae 0.9087 1 227
3s6j-assembly3.cif.gz_C the crystal structure of a hydrolase from pseudomonas syringae 0.9015 4 227
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.9005 1 227
ID Description Score Start End Superfamily
af_D7SFJ0_151_278_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9194 94 219 3.40.50.1000
2hi0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.911 90 227 3.40.50.1000
2yy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8991 94 225 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8976 96 213 3.40.50.1000
3kbbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.882 95 227 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A261Q429-F1-model_v4 Phosphonoacetaldehyde hydrolase 0.994 1 228 GO:0005829
GO:0006281
GO:0008967
AF-A0A5B8V8F9-F1-model_v4 HAD-IA family hydrolase 0.9933 3 228 GO:0005829
GO:0006281
GO:0008967
AF-A0A261Q429-F1-model_v4 Phosphonoacetaldehyde hydrolase 0.9896 1 228 GO:0005829
GO:0006281
GO:0008967
AF-A0A4Q5Y294-F1-model_v4 HAD family hydrolase 0.9873 34 226 GO:0005829
GO:0006281
GO:0008967
AF-A0A5C8DK24-F1-model_v4 HAD family hydrolase 0.9863 1 226 GO:0005829
GO:0006281
GO:0008967

Feature Viewer

pLDDT pTM Quality
94.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map