F193409

General Info

Members Datasets Scaffolds Average Seq Length
145 115 290 201

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10006544|JGI25406J46586_100065444
Length 217
Sequence MRRHEAIRGSSIRTDGTLTSMRLAGWMLGAVLVLASIGAAHAQATTTDNGSNYVIGPGDTVQVFVWRNPELSVSVPVRPDGKISTPLVEDMIAVGKTPSQLARDVERVLTEYVRAPQVNIIVTNAQSAFNQVKILGQVRNPQSVAFREGMTVLDAVLAAGGLTEFAAGNRARLLRKDASGTEKPTRLRLDDLMKKGRAADNPPVKPGDVIVVPEAMF

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
92 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
93 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
94 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
95 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.41
Rhizosphere 82.07
Stem 0
Stem Tuber 0
Unclassified 18.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006544 3300003203 Bacteria 5359
2 Ga0065707_10082015 3300005295 Bacteria 24731
3 Ga0070683_100319231 3300005329 Unclassified 1478
4 Ga0070690_100029497 3300005330 Bacteria 3404
5 Ga0070666_10002297 3300005335 Bacteria 11557
6 Ga0070682_100014449 3300005337 Bacteria 4563
7 Ga0070689_100036772 3300005340 Bacteria 3744
8 Ga0070689_100783105 3300005340 Bacteria 838
9 Ga0070691_10082799 3300005341 Bacteria 1573
10 Ga0070687_100077568 3300005343 Bacteria 1803
11 Ga0070692_10043638 3300005345 Bacteria 2307
12 Ga0070671_100399737 3300005355 Bacteria 1175
13 Ga0070688_100028273 3300005365 Bacteria 3346
14 Ga0070667_100000129 3300005367 Bacteria 95291
15 Ga0070667_100295955 3300005367 Unclassified 1456
16 Ga0070713_100239154 3300005436 Bacteria 1653
17 Ga0070701_10048903 3300005438 Bacteria 2184
18 Ga0070711_100103347 3300005439 Unclassified 2076
19 Ga0070705_100131723 3300005440 Bacteria 1632
20 Ga0070700_100101082 3300005441 Unclassified 1900
21 Ga0070700_100197641 3300005441 Bacteria 1410
22 Ga0070681_10015408 3300005458 Bacteria 7608
23 Ga0070686_100001377 3300005544 Bacteria 13725
24 Ga0070695_100035236 3300005545 Bacteria 3143
25 Ga0070696_100000146 3300005546 Bacteria 39211
26 Ga0070696_100043571 3300005546 Bacteria 3105
27 Ga0070696_100052570 3300005546 Bacteria 2834
28 Ga0070665_100029048 3300005548 Bacteria 5566
29 Ga0068856_100210091 3300005614 Bacteria 1961
30 Ga0070702_100002551 3300005615 Bacteria 7914
31 Ga0068859_100448307 3300005617 Bacteria 1387
32 Ga0068864_100020192 3300005618 Bacteria 5573
33 Ga0068861_100005378 3300005719 Bacteria 8659
34 Ga0068861_100024357 3300005719 Bacteria 4377
35 Ga0068861_100256314 3300005719 Bacteria 1495
36 Ga0068863_100057179 3300005841 Bacteria 3692
37 Ga0068858_100077119 3300005842 Bacteria 3096
38 Ga0068862_100053190 3300005844 Bacteria 3465
39 Ga0081455_10001635 3300005937 Bacteria 27287
40 Ga0081539_10000001 3300005985 Bacteria 808331
41 Ga0070715_10077562 3300006163 Bacteria 1500
42 Ga0070716_100253102 3300006173 Bacteria 1201
43 Ga0097620_100448293 3300006931 Bacteria 1387
44 Ga0099794_10034100 3300007265 Bacteria 2396
45 Ga0099794_10064400 3300007265 Unclassified 1786
46 Ga0105240_10156959 3300009093 Unclassified 2705
47 Ga0105247_10001367 3300009101 Bacteria 17700
48 Ga0105247_10166559 3300009101 Unclassified 1463
49 Ga0105242_10194469 3300009176 Bacteria 1798
50 Ga0105249_10661094 3300009553 Bacteria 1103
51 Ga0099796_10000336 3300010159 Bacteria 7608
52 Ga0105246_10460288 3300011119 Unclassified 1071
53 Ga0157378_10084658 3300013297 Bacteria 2871
54 Ga0163162_10345310 3300013306 Bacteria 1621
55 Ga0163162_10578248 3300013306 Viruses 1250
56 Ga0157375_10361929 3300013308 Bacteria 1617
57 Ga0157375_10461808 3300013308 Bacteria 1435
58 Ga0157380_10083635 3300014326 Unclassified 2615
59 Ga0157380_11601185 3300014326 Bacteria 707
60 Ga0157379_10065821 3300014968 Bacteria 3240
61 Ga0157379_10182078 3300014968 Bacteria 1898
62 Ga0157379_10403108 3300014968 Bacteria 1257
63 Ga0213876_10144513 3300021384 Bacteria 1265
64 Ga0207710_10002232 3300025900 Bacteria 9094
65 Ga0207688_10122191 3300025901 Bacteria 1520
66 Ga0207680_10022577 3300025903 Bacteria 3425
67 Ga0207680_10055140 3300025903 Unclassified 2394
68 Ga0207707_10042034 3300025912 Bacteria 3991
69 Ga0207707_10160727 3300025912 Unclassified 1964
70 Ga0207695_10129747 3300025913 Bacteria 2479
71 Ga0207693_10004653 3300025915 Bacteria 11576
72 Ga0207663_10682501 3300025916 Viruses 812
73 Ga0207659_10043528 3300025926 Unclassified 3153
74 Ga0207644_10311087 3300025931 Bacteria 1272
75 Ga0207644_10391199 3300025931 Unclassified 1135
76 Ga0207670_10036615 3300025936 Bacteria 3192
77 Ga0207669_10083357 3300025937 Unclassified 2056
78 Ga0207661_10362731 3300025944 Unclassified 1309
79 Ga0207679_10061870 3300025945 Bacteria 2788
80 Ga0207712_10122375 3300025961 Unclassified 1970
81 Ga0207658_10000126 3300025986 Bacteria 83451
82 Ga0207677_10984143 3300026023 Viruses 764
83 Ga0207678_10289458 3300026067 Bacteria 1407
84 Ga0207708_10139035 3300026075 Unclassified 1904
85 Ga0207641_10508751 3300026088 Bacteria 1170
86 Ga0207648_10300614 3300026089 Bacteria 1439
87 Ga0207676_10022139 3300026095 Bacteria 4673
88 Ga0207675_100001038 3300026118 Bacteria 27534
89 Ga0207675_100002939 3300026118 Bacteria 16760
90 Ga0207683_10240188 3300026121 Unclassified 1652
91 Ga0209588_1020018 3300027671 Unclassified 2093
92 Ga0268266_10023720 3300028379 Bacteria 5222
93 Ga0265338_10039705 3300028800 Unclassified 4435
94 Ga0265770_1001892 3300030878 Unclassified 2857
95 Ga0265765_1002022 3300030879 Bacteria 1930
96 Ga0265340_10032964 3300031247 Unclassified 2582
97 Ga0307513_10155377 3300031456 Bacteria 2188
98 Ga0307408_100067235 3300031548 Bacteria 2635
99 Ga0307514_10231576 3300031649 Unclassified 1119
100 Ga0316576_10402201 3300031727 Unclassified 1015
101 Ga0307410_10128320 3300031852 Bacteria 1859
102 Ga0307410_10197627 3300031852 Bacteria 1533
103 Ga0307406_10013288 3300031901 Bacteria 4714
104 Ga0307407_10014624 3300031903 Bacteria 3851
105 Ga0307407_10245439 3300031903 Bacteria 1224
106 Ga0307409_100120299 3300031995 Bacteria 2222
107 Ga0307409_100210985 3300031995 Bacteria 1745
108 Ga0307416_100022006 3300032002 Bacteria 4591
109 Ga0307416_100119171 3300032002 Unclassified 2347
110 Ga0307416_100918197 3300032002 Bacteria 976
111 Ga0307411_10000276 3300032005 Bacteria 17006
112 Ga0307411_10027939 3300032005 Bacteria 3422
113 Ga0307411_10594263 3300032005 Bacteria 951
114 Ga0307415_100172100 3300032126 Bacteria 1690
115 Ga0436365_0551128 3300039437 Bacteria 1582
116 Ga0436365_1002627 3300039437 Unclassified 1787
117 Ga0451789_0212249 3300041443 Bacteria 1101
118 Ga0451791_0135450 3300041451 Bacteria 7066
119 Ga0451793_1326309 3300041452 Bacteria 2241
120 Ga0451800_0107051 3300041459 Bacteria 3123
121 Ga0451802_0237924 3300041460 Bacteria 1511
122 Ga0451802_2200387 3300041460 Bacteria 1174
123 Ga0451807_0143058 3300041486 Bacteria 6399
124 Ga0451837_0199986 3300041494 Bacteria 1452
125 Ga0451853_1290915 3300041512 Unclassified 860
126 Ga0451577_0029049 3300042876 Bacteria 5000
127 Ga0495668_0160371 3300046616 Bacteria 1232
128 Ga0495625_0011964 3300046660 Bacteria 7044
129 Ga0495625_0028947 3300046660 Bacteria 4147
130 Ga0495613_0556158 3300046689 Bacteria 767
131 Ga0495649_0002310 3300046694 Bacteria 13532
132 Ga0496100_0020424 3300048903 Bacteria 3971
133 Ga0496101_0248632 3300048904 Bacteria 1385
134 Ga0496102_0396464 3300048905 Bacteria 1298
135 Ga0496104_0008236 3300048907 Bacteria 9257
136 Ga0496105_0004595 3300048908 Bacteria 10400
137 Ga0496105_0227256 3300048908 Bacteria 1517
138 Ga0496106_0101839 3300048909 Bacteria 2228
139 Ga0496107_0092240 3300048910 Bacteria 2214
140 Ga0496107_0340095 3300048910 Bacteria 1117
141 Ga0496114_0026214 3300048917 Bacteria 4771
142 Ga0496115_0004758 3300048918 Bacteria 9852
143 Ga0496118_0023394 3300048921 Bacteria 5368
144 Ga0495612_0391182 3300053078 Bacteria 631
145 Ga0495619_0311808 3300053085 Bacteria 1090
146 JGI25406J46586_10006544
147 Ga0065707_10082015
148 Ga0070683_100319231
149 Ga0070690_100029497
150 Ga0070666_10002297
151 Ga0070682_100014449
152 Ga0070689_100036772
153 Ga0070689_100783105
154 Ga0070691_10082799
155 Ga0070687_100077568
156 Ga0070692_10043638
157 Ga0070671_100399737
158 Ga0070688_100028273
159 Ga0070667_100000129
160 Ga0070667_100295955
161 Ga0070713_100239154
162 Ga0070701_10048903
163 Ga0070711_100103347
164 Ga0070705_100131723
165 Ga0070700_100101082
166 Ga0070700_100197641
167 Ga0070681_10015408
168 Ga0070686_100001377
169 Ga0070695_100035236
170 Ga0070696_100000146
171 Ga0070696_100043571
172 Ga0070696_100052570
173 Ga0070665_100029048
174 Ga0068856_100210091
175 Ga0070702_100002551
176 Ga0068859_100448307
177 Ga0068864_100020192
178 Ga0068861_100005378
179 Ga0068861_100024357
180 Ga0068861_100256314
181 Ga0068863_100057179
182 Ga0068858_100077119
183 Ga0068862_100053190
184 Ga0081455_10001635
185 Ga0081539_10000001
186 Ga0070715_10077562
187 Ga0070716_100253102
188 Ga0097620_100448293
189 Ga0099794_10034100
190 Ga0099794_10064400
191 Ga0105240_10156959
192 Ga0105247_10001367
193 Ga0105247_10166559
194 Ga0105242_10194469
195 Ga0105249_10661094
196 Ga0099796_10000336
197 Ga0105246_10460288
198 Ga0157378_10084658
199 Ga0163162_10345310
200 Ga0163162_10578248
201 Ga0157375_10361929
202 Ga0157375_10461808
203 Ga0157380_10083635
204 Ga0157380_11601185
205 Ga0157379_10065821
206 Ga0157379_10182078
207 Ga0157379_10403108
208 Ga0213876_10144513
209 Ga0207710_10002232
210 Ga0207688_10122191
211 Ga0207680_10022577
212 Ga0207680_10055140
213 Ga0207707_10042034
214 Ga0207707_10160727
215 Ga0207695_10129747
216 Ga0207693_10004653
217 Ga0207663_10682501
218 Ga0207659_10043528
219 Ga0207644_10311087
220 Ga0207644_10391199
221 Ga0207670_10036615
222 Ga0207669_10083357
223 Ga0207661_10362731
224 Ga0207679_10061870
225 Ga0207712_10122375
226 Ga0207658_10000126
227 Ga0207677_10984143
228 Ga0207678_10289458
229 Ga0207708_10139035
230 Ga0207641_10508751
231 Ga0207648_10300614
232 Ga0207676_10022139
233 Ga0207675_100001038
234 Ga0207675_100002939
235 Ga0207683_10240188
236 Ga0209588_1020018
237 Ga0268266_10023720
238 Ga0265338_10039705
239 Ga0265770_1001892
240 Ga0265765_1002022
241 Ga0265340_10032964
242 Ga0307513_10155377
243 Ga0307408_100067235
244 Ga0307514_10231576
245 Ga0316576_10402201
246 Ga0307410_10128320
247 Ga0307410_10197627
248 Ga0307406_10013288
249 Ga0307407_10014624
250 Ga0307407_10245439
251 Ga0307409_100120299
252 Ga0307409_100210985
253 Ga0307416_100022006
254 Ga0307416_100119171
255 Ga0307416_100918197
256 Ga0307411_10000276
257 Ga0307411_10027939
258 Ga0307411_10594263
259 Ga0307415_100172100
260 Ga0436365_0551128
261 Ga0436365_1002627
262 Ga0451789_0212249
263 Ga0451791_0135450
264 Ga0451793_1326309
265 Ga0451800_0107051
266 Ga0451802_0237924
267 Ga0451802_2200387
268 Ga0451807_0143058
269 Ga0451837_0199986
270 Ga0451853_1290915
271 Ga0451577_0029049
272 Ga0495668_0160371
273 Ga0495625_0011964
274 Ga0495625_0028947
275 Ga0495613_0556158
276 Ga0495649_0002310
277 Ga0496100_0020424
278 Ga0496101_0248632
279 Ga0496102_0396464
280 Ga0496104_0008236
281 Ga0496105_0004595
282 Ga0496105_0227256
283 Ga0496106_0101839
284 Ga0496107_0092240
285 Ga0496107_0340095
286 Ga0496114_0026214
287 Ga0496115_0004758
288 Ga0496118_0023394
289 Ga0495612_0391182
290 Ga0495619_0311808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02563

Poly_export

Polysaccharide biosynthesis/export protein

47

123

0.96

PF10531

SLBB

SLBB domain

131

185

0.94

PF22461

SLBB_2

SLBB domain

130

212

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dss-assembly1.cif.gz_B x-ray crystal structure of geobacillus stearothermophilus comea 0.8346 130 214
7xff-assembly1.cif.gz_H polysaccharide export protein wza 0.8187 50 214
7xff-assembly1.cif.gz_B polysaccharide export protein wza 0.8167 50 214
2j58-assembly1.cif.gz_H the structure of wza 0.8042 50 214
2w8i-assembly1.cif.gz_E crystal structure of wza24-345. 0.8027 50 214
ID Description Score Start End Superfamily
2w8hA03 Alpha Beta;2-Layer Sandwich;wza like fold;wza like domain 0.9595 56 122 3.30.1950.10
af_P71728_139_194_3.10.560.10 Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like 0.9237 132 167 3.10.560.10
2j58A02 Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like 0.8321 134 214 3.10.560.10
2w8hA02 Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like 0.8196 123 217 3.10.560.10
2w8hA03 Alpha Beta;2-Layer Sandwich;wza like fold;wza like domain 0.7797 56 122 3.30.1950.10
ID Description Score Start End GO Terms
AF-A0A536VZ70-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9367 123 217 GO:0015159
AF-A0A2V5UV32-F1-model_v4 Soluble ligand binding domain-containing protein 0.9283 130 216 GO:0015159
AF-A0A7V4DC34-F1-model_v4 Soluble ligand binding domain-containing protein 0.9257 130 217 GO:0015159
AF-A0A521ZWH4-F1-model_v4 Polysaccharide export protein EpsE 0.9248 129 217 GO:0015159
AF-A0A536VZ70-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9176 123 217 GO:0015159

Map