F192484

General Info

Members Datasets Scaffolds Average Seq Length
144 68 286 359

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000150|Ga0451577_0000150_45399_46610
Length 403
Sequence MGLLGGPETPKLGRTIQQRRLAAAIATARAXAQAGGVTSSPMSNSDGMNYAPQGKPAPVVGGRDFVFAAAFLEHGHIYGQCNGLIEAGAVLKWVYDADPAKVAAFTKTYPQVRVARSFEEILADDEVRLVAAAAIPCDRGPLGCRVLRAGKDYFTDKTPFTTLAQLDEARRTVAETGRKYSVYYSERIHTESGMFAADLVRAGAVGRVVQVAGFGPHRLSKAARPAWFFERARYGGILCDIGSHQFEQFLTYSGATDARVAHAAVGNFANADRPELEDFGEASLIGDNGATNHIRVDWLTPDGLGTWGDGRILILGTEGYIELRKYIEVGRERTQDHVYLVDAKGERHFHVHGQVGFRFFGELVLDCLHRTERAMTQAHTFKAAELCLKAQAAAVNLTPQTLR

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
13 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
18 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
25 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
26 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
27 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
28 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
32 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
33 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
34 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
40 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
41 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
42 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
43 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
44 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
45 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
46 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
47 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
49 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
53 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
55 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
56 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
60 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
61 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
62 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
63 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
66 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
67 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
68 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 0
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0000150 3300042876 Bacteria 154181
2 rootH2_10050598 3300003320 Bacteria 7256
3 rootH2_10103288 3300003320 Bacteria 4888
4 Ga0065707_10000979 3300005295 Bacteria 8983
5 Ga0070658_10005045 3300005327 Bacteria 10748
6 Ga0070683_100001399 3300005329 Bacteria 18515
7 Ga0070668_100082530 3300005347 Bacteria 2521
8 Ga0070709_10141600 3300005434 Bacteria 1653
9 Ga0070679_100024068 3300005530 Bacteria 5965
10 Ga0068857_100054409 3300005577 Bacteria 3551
11 Ga0068856_100024770 3300005614 Bacteria 5845
12 Ga0068856_100103391 3300005614 Bacteria 2842
13 Ga0070717_10000012 3300006028 Bacteria 230311
14 Ga0075366_10061676 3300006195 Bacteria 2229
15 Ga0157371_10084212 3300013102 Bacteria 2252
16 Ga0157369_10164391 3300013105 Bacteria 2341
17 Ga0157375_10256521 3300013308 Bacteria 1910
18 Ga0163163_10053449 3300014325 Bacteria 3987
19 Ga0163161_10067578 3300017792 Bacteria 2610
20 Ga0207705_10081784 3300025909 Bacteria 2354
21 Ga0207652_10138464 3300025921 Bacteria 2175
22 Ga0207661_10152726 3300025944 Bacteria 1997
23 Ga0207668_10055511 3300025972 Bacteria 2754
24 Ga0207702_10001258 3300026078 Bacteria 25541
25 Ga0207674_10068893 3300026116 Bacteria 3559
26 Ga0265337_1000982 3300028556 Bacteria 14910
27 Ga0265319_1001117 3300028563 Bacteria 16706
28 Ga0265319_1002076 3300028563 Bacteria 11238
29 Ga0265319_1004880 3300028563 Bacteria 6560
30 Ga0265319_1008376 3300028563 Bacteria 4539
31 Ga0265319_1009847 3300028563 Bacteria 4033
32 Ga0265319_1013817 3300028563 Bacteria 3192
33 Ga0265319_1026887 3300028563 Unclassified 2045
34 Ga0265319_1029583 3300028563 Bacteria 1922
35 Ga0265319_1050828 3300028563 Bacteria 1368
36 Ga0265334_10007872 3300028573 Bacteria 4558
37 Ga0265318_10000007 3300028577 Bacteria 280699
38 Ga0265318_10014936 3300028577 Bacteria 3246
39 Ga0265323_10027192 3300028653 Bacteria 2149
40 Ga0265323_10036133 3300028653 Bacteria 1818
41 Ga0265323_10043104 3300028653 Bacteria 1630
42 Ga0307515_10234615 3300028794 Bacteria 1619
43 Ga0265338_10000082 3300028800 Bacteria 176343
44 Ga0265324_10014204 3300029957 Bacteria 2951
45 Ga0265330_10047213 3300031235 Bacteria 1895
46 Ga0265330_10056425 3300031235 Bacteria 1714
47 Ga0265330_10077679 3300031235 Bacteria 1432
48 Ga0265320_10000194 3300031240 Bacteria 50070
49 Ga0265320_10000407 3300031240 Bacteria 34383
50 Ga0265320_10001460 3300031240 Bacteria 17261
51 Ga0265320_10001682 3300031240 Bacteria 15726
52 Ga0265320_10001900 3300031240 Bacteria 14740
53 Ga0265320_10007081 3300031240 Bacteria 6992
54 Ga0265320_10013653 3300031240 Bacteria 4659
55 Ga0265320_10014825 3300031240 Bacteria 4421
56 Ga0265320_10038318 3300031240 Bacteria 2406
57 Ga0265320_10055104 3300031240 Bacteria 1915
58 Ga0265325_10016554 3300031241 Bacteria 4121
59 Ga0265327_10000023 3300031251 Bacteria 382703
60 Ga0265327_10000643 3300031251 Bacteria 56654
61 Ga0265316_10008848 3300031344 Bacteria 9298
62 Ga0265316_10032030 3300031344 Bacteria 4295
63 Ga0265313_10001006 3300031595 Bacteria 27620
64 Ga0265313_10002081 3300031595 Bacteria 17894
65 Ga0265313_10003407 3300031595 Bacteria 12886
66 Ga0265313_10005528 3300031595 Bacteria 9265
67 Ga0265313_10008278 3300031595 Bacteria 6932
68 Ga0265313_10066330 3300031595 Bacteria 1673
69 Ga0307508_10000068 3300031616 Bacteria 119901
70 Ga0307508_10000449 3300031616 Bacteria 49299
71 Ga0265314_10000594 3300031711 Bacteria 45538
72 Ga0265314_10004037 3300031711 Bacteria 13877
73 Ga0265314_10062984 3300031711 Bacteria 2518
74 Ga0265342_10004395 3300031712 Bacteria 11124
75 Ga0395905_0099510 3300037471 Bacteria 2731
76 Ga0439445_0039102 3300042004 Bacteria 1256
77 Ga0451577_0000664 3300042876 Bacteria 54187
78 Ga0451577_0001860 3300042876 Bacteria 26905
79 Ga0451577_0019906 3300042876 Bacteria 6165
80 Ga0453684_0018128 3300044712 Bacteria 10836
81 Ga0453684_0032169 3300044712 Bacteria 7351
82 Ga0453684_0046269 3300044712 Bacteria 5789
83 Ga0453684_0464487 3300044712 Bacteria 1407
84 Ga0453684_0532600 3300044712 Bacteria 1296
85 Ga0451576_0165580 3300045051 Bacteria 2307
86 Ga0466967_0071917 3300045976 Bacteria 3098
87 Ga0496122_0006641 3300048925 Bacteria 13193
88 Ga0501031_0013536 3300049568 Bacteria 5315
89 Ga0501032_0002763 3300049569 Bacteria 13672
90 Ga0501032_0003972 3300049569 Bacteria 11213
91 Ga0501032_0050186 3300049569 Bacteria 2814
92 Ga0501032_0094644 3300049569 Bacteria 1980
93 Ga0501033_0000412 3300049570 Bacteria 40934
94 Ga0501033_0001102 3300049570 Bacteria 24495
95 Ga0501033_0002226 3300049570 Bacteria 16674
96 Ga0501033_0004061 3300049570 Bacteria 11819
97 Ga0501036_0072859 3300049572 Bacteria 2903
98 Ga0501036_0126357 3300049572 Bacteria 2159
99 Ga0501037_0092489 3300049573 Bacteria 2187
100 Ga0501037_0132237 3300049573 Bacteria 1789
101 Ga0501038_0003065 3300049574 Bacteria 15576
102 Ga0501038_0092282 3300049574 Bacteria 2535
103 Ga0501038_0267054 3300049574 Bacteria 1350
104 Ga0501039_0029065 3300049575 Bacteria 4256
105 Ga0501039_0042564 3300049575 Bacteria 3508
106 Ga0501042_0024482 3300049578 Bacteria 4234
107 Ga0501043_0118289 3300049579 Bacteria 2078
108 Ga0501043_0148042 3300049579 Bacteria 1838
109 Ga0501043_0209544 3300049579 Bacteria 1511
110 Ga0501046_0002949 3300049580 Bacteria 15740
111 Ga0501046_0005286 3300049580 Bacteria 11551
112 Ga0501046_0014639 3300049580 Bacteria 6608
113 Ga0501047_0003096 3300049581 Bacteria 15787
114 Ga0501047_0024909 3300049581 Bacteria 5746
115 Ga0501047_0045182 3300049581 Bacteria 4258
116 Ga0501047_0047015 3300049581 Bacteria 4170
117 Ga0501047_0054098 3300049581 Bacteria 3882
118 Ga0501047_0145248 3300049581 Bacteria 2249
119 Ga0501048_0001736 3300049582 Bacteria 16587
120 Ga0501048_0049980 3300049582 Bacteria 2978
121 Ga0501068_0094081 3300049584 Bacteria 1852
122 Ga0501070_0069296 3300049586 Bacteria 2920
123 Ga0501070_0215294 3300049586 Bacteria 1576
124 Ga0501080_0036074 3300049742 Bacteria 4616
125 Ga0501080_0109316 3300049742 Bacteria 2563
126 Ga0501080_0220029 3300049742 Bacteria 1738
127 Ga0501083_0002600 3300049744 Bacteria 12431
128 Ga0501083_0007307 3300049744 Bacteria 7830
129 Ga0501083_0042089 3300049744 Bacteria 3098
130 Ga0501083_0050218 3300049744 Bacteria 2808
131 Ga0501035_0003595 3300049822 Bacteria 14808
132 Ga0501035_0006195 3300049822 Bacteria 11253
133 Ga0501035_0032078 3300049822 Bacteria 4782
134 Ga0501035_0113720 3300049822 Bacteria 2371
135 Ga0501044_0002898 3300049823 Bacteria 19536
136 Ga0501044_0008542 3300049823 Bacteria 11223
137 Ga0501044_0057851 3300049823 Bacteria 3977
138 Ga0501044_0099189 3300049823 Bacteria 2931
139 Ga0501044_0204940 3300049823 Bacteria 1929
140 Ga0501045_0153283 3300049824 Bacteria 1715
141 Ga0500556_0002270 3300053104 Bacteria 6356
142 Ga0500645_008217 3300053730 Bacteria 3580
143 2788433102 2786546940 Bacteria 6396474
144 Ga0451577_0000150
145 rootH2_10050598
146 rootH2_10103288
147 Ga0065707_10000979
148 Ga0070658_10005045
149 Ga0070683_100001399
150 Ga0070668_100082530
151 Ga0070709_10141600
152 Ga0070679_100024068
153 Ga0068857_100054409
154 Ga0068856_100024770
155 Ga0068856_100103391
156 Ga0070717_10000012
157 Ga0075366_10061676
158 Ga0157371_10084212
159 Ga0157369_10164391
160 Ga0157375_10256521
161 Ga0163163_10053449
162 Ga0163161_10067578
163 Ga0207705_10081784
164 Ga0207652_10138464
165 Ga0207661_10152726
166 Ga0207668_10055511
167 Ga0207702_10001258
168 Ga0207674_10068893
169 Ga0265337_1000982
170 Ga0265319_1001117
171 Ga0265319_1002076
172 Ga0265319_1004880
173 Ga0265319_1008376
174 Ga0265319_1009847
175 Ga0265319_1013817
176 Ga0265319_1026887
177 Ga0265319_1029583
178 Ga0265319_1050828
179 Ga0265334_10007872
180 Ga0265318_10000007
181 Ga0265318_10014936
182 Ga0265323_10027192
183 Ga0265323_10036133
184 Ga0265323_10043104
185 Ga0307515_10234615
186 Ga0265338_10000082
187 Ga0265324_10014204
188 Ga0265330_10047213
189 Ga0265330_10056425
190 Ga0265330_10077679
191 Ga0265320_10000194
192 Ga0265320_10000407
193 Ga0265320_10001460
194 Ga0265320_10001682
195 Ga0265320_10001900
196 Ga0265320_10007081
197 Ga0265320_10013653
198 Ga0265320_10014825
199 Ga0265320_10038318
200 Ga0265320_10055104
201 Ga0265325_10016554
202 Ga0265327_10000023
203 Ga0265327_10000643
204 Ga0265316_10008848
205 Ga0265316_10032030
206 Ga0265313_10001006
207 Ga0265313_10002081
208 Ga0265313_10003407
209 Ga0265313_10005528
210 Ga0265313_10008278
211 Ga0265313_10066330
212 Ga0307508_10000068
213 Ga0307508_10000449
214 Ga0265314_10000594
215 Ga0265314_10004037
216 Ga0265314_10062984
217 Ga0265342_10004395
218 Ga0395905_0099510
219 Ga0439445_0039102
220 Ga0451577_0000664
221 Ga0451577_0001860
222 Ga0451577_0019906
223 Ga0453684_0018128
224 Ga0453684_0032169
225 Ga0453684_0046269
226 Ga0453684_0464487
227 Ga0453684_0532600
228 Ga0451576_0165580
229 Ga0466967_0071917
230 Ga0496122_0006641
231 Ga0501031_0013536
232 Ga0501032_0002763
233 Ga0501032_0003972
234 Ga0501032_0050186
235 Ga0501032_0094644
236 Ga0501033_0000412
237 Ga0501033_0001102
238 Ga0501033_0002226
239 Ga0501033_0004061
240 Ga0501036_0072859
241 Ga0501036_0126357
242 Ga0501037_0092489
243 Ga0501037_0132237
244 Ga0501038_0003065
245 Ga0501038_0092282
246 Ga0501038_0267054
247 Ga0501039_0029065
248 Ga0501039_0042564
249 Ga0501042_0024482
250 Ga0501043_0118289
251 Ga0501043_0148042
252 Ga0501043_0209544
253 Ga0501046_0002949
254 Ga0501046_0005286
255 Ga0501046_0014639
256 Ga0501047_0003096
257 Ga0501047_0024909
258 Ga0501047_0045182
259 Ga0501047_0047015
260 Ga0501047_0054098
261 Ga0501047_0145248
262 Ga0501048_0001736
263 Ga0501048_0049980
264 Ga0501068_0094081
265 Ga0501070_0069296
266 Ga0501070_0215294
267 Ga0501080_0036074
268 Ga0501080_0109316
269 Ga0501080_0220029
270 Ga0501083_0002600
271 Ga0501083_0007307
272 Ga0501083_0042089
273 Ga0501083_0050218
274 Ga0501035_0003595
275 Ga0501035_0006195
276 Ga0501035_0032078
277 Ga0501035_0113720
278 Ga0501044_0002898
279 Ga0501044_0008542
280 Ga0501044_0057851
281 Ga0501044_0099189
282 Ga0501044_0204940
283 Ga0501045_0153283
284 Ga0500556_0002270
285 Ga0500645_008217
286 2788433102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

194

322

0.94

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

69

184

0.92

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

197

355

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u3x-assembly3.cif.gz_M crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 0.9801 24 351
2p2s-assembly1.cif.gz_B crystal structure of putative oxidoreductase (yp_050235.1) from erwinia carotovora atroseptica scri1043 at 1.25 a resolution 0.9766 25 354
3u3x-assembly3.cif.gz_M crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 0.9713 24 351
2p2s-assembly1.cif.gz_B crystal structure of putative oxidoreductase (yp_050235.1) from erwinia carotovora atroseptica scri1043 at 1.25 a resolution 0.9651 25 354
3ip3-assembly4.cif.gz_G structure of putative oxidoreductase (tm_0425) from thermotoga maritima 0.8769 25 350
ID Description Score Start End Superfamily
3u3xA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9897 24 142 3.40.50.720
2p2sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9718 25 143 3.40.50.720
2p2sB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9678 146 354 3.30.360.10
2p2sB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.953 146 354 3.30.360.10
3u3xG02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9506 145 351 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A7X7IX08-F1-model_v4 deleted 0.9823 13 350
AF-A0A7C5QIQ7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9805 111 353
AF-A0A7X7IX08-F1-model_v4 deleted 0.9569 13 350
AF-A0A7C5QIQ7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9532 111 353
AF-A0A1S9CA72-F1-model_v4 Oxidoreductase 0.9271 8 354 GO:0000166
GO:0016491

Map