F192136

General Info

Members Datasets Scaffolds Average Seq Length
144 78 288 350

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10062145|Ga0265327_100621451
Length 428
Sequence MTCKPFTTETQRHREHQPSFLFYSVSLVKQLAIRLRQATAPAKSLVMCLCGLIFFLTACGKEPFYQEQAYVFGTQVDVSIYGEDDAKARQAVGSVMHEFQRLHDLLHAWKPSELSELNAAIAQGKEKVVSAEVAAMLQDAARMSAQSSGLFNPAIGGLIQTWGFQADDFKPVLPDEKKIASLLKANPQMDDLIFASEPNPSLPPLVRGGADRAPLTAKGSLQSSGEPTGVLLAGAGGAGGVKVSSRNPVVKLDLGGYAKGYALDRAVAVLKQQGVHNALINIGGNVLALGQHGSRAWRVGIQHPRKPGPLATLELRDGEAIGTSGDYQRYFEFNGKRYCHLIDPRNGYPAQGTQAVTILTHGERAGLLSDGSSKPLFISGAQGWRAAARQMQINEAMLIDADGVVHLTADLQKRLEFTDKSTLSKVEP

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
22 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
23 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
24 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
30 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
36 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
37 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
38 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
39 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
44 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
45 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
46 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
47 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
48 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
49 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
52 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
61 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
62 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
63 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
64 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
67 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
68 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
69 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
70 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
71 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
72 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
73 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
74 2643221638 Duganella sp. Root336D2 Isolate Unclassified
75 2643221645 Massilia sp. Root351 Isolate Unclassified
76 2643221664 Massilia sp. Root418 Isolate Unclassified
77 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
78 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 0
Isolates 4.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.42
Nodule 0
Rhizoplane 0.69
Rhizosphere 59.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10062145 3300031251 Bacteria 1902
2 JGI25158J39367_1000207 3300002739 Bacteria 13953
3 JGI25158J39367_1000834 3300002739 Bacteria 5888
4 JGI25152J39213_1000115 3300002773 Bacteria 55874
5 JGI25152J39213_1011418 3300002773 Bacteria 1965
6 JGI25150J39212_1000197 3300002774 Bacteria 33435
7 JGI25150J39212_1001631 3300002774 Bacteria 6109
8 JGI25159J45721_1001666 3300002987 Bacteria 9001
9 JGI25159J45721_1005396 3300002987 Bacteria 4020
10 rootH2_10085593 3300003320 Bacteria 1791
11 JGI25160J50197_1003518 3300003354 Bacteria 6986
12 JGI25161J50226_1001361 3300003374 Bacteria 7513
13 JGI25161J50226_1001630 3300003374 Bacteria 6503
14 Ga0055526_1002952 3300003771 Bacteria 11148
15 Ga0055537_1005854 3300003773 Bacteria 3218
16 Ga0055524_1000801 3300003775 Bacteria 20840
17 Ga0055524_1001833 3300003775 Bacteria 11638
18 Ga0055534_1000907 3300003784 Bacteria 13356
19 Ga0055534_1001265 3300003784 Bacteria 10336
20 Ga0055530_10001212 3300003791 Bacteria 19941
21 Ga0055530_10004598 3300003791 Bacteria 7033
22 Ga0055530_10008209 3300003791 Bacteria 4223
23 Ga0055531_10022079 3300003794 Bacteria 2441
24 Ga0055531_10031945 3300003794 Bacteria 1731
25 Ga0055543_1001293 3300004625 Bacteria 10280
26 Ga0065165_1000507 3300005262 Bacteria 59988
27 Ga0065714_10029215 3300005288 Bacteria 1492
28 Ga0070716_100004507 3300006173 Bacteria 6668
29 Ga0075436_100023188 3300006914 Bacteria 4264
30 Ga0105240_10251357 3300009093 Bacteria 2044
31 Ga0209436_100730 3300025208 Bacteria 13734
32 Ga0209436_101571 3300025208 Bacteria 7719
33 Ga0207425_1000006 3300025245 Bacteria 808854
34 Ga0207425_1000105 3300025245 Bacteria 78746
35 Ga0209129_1000090 3300025258 Bacteria 175755
36 Ga0209129_1011380 3300025258 Bacteria 2129
37 Ga0209565_1000680 3300025263 Bacteria 21200
38 Ga0209565_1000748 3300025263 Bacteria 19155
39 Ga0209565_1001068 3300025263 Bacteria 13762
40 Ga0209565_1004302 3300025263 Bacteria 4378
41 Ga0209673_1007971 3300025273 Bacteria 4780
42 Ga0209130_1000298 3300025284 Bacteria 60508
43 Ga0209130_1005105 3300025284 Bacteria 4678
44 Ga0209675_1001569 3300025291 Bacteria 12963
45 Ga0209675_1001772 3300025291 Bacteria 11809
46 Ga0209564_1000513 3300025295 Bacteria 63602
47 Ga0209564_1011056 3300025295 Bacteria 4081
48 Ga0209758_1000047 3300025297 Bacteria 360971
49 Ga0209050_1000085 3300025298 Bacteria 263219
50 Ga0209050_1000984 3300025298 Bacteria 36274
51 Ga0209050_1001090 3300025298 Bacteria 32998
52 Ga0209256_1000080 3300025299 Bacteria 224592
53 Ga0209256_1003079 3300025299 Bacteria 12241
54 Ga0209256_1004617 3300025299 Bacteria 8502
55 Ga0207426_1004267 3300025302 Bacteria 7084
56 Ga0209257_1000010 3300025304 Bacteria 1158682
57 Ga0209257_1004253 3300025304 Bacteria 11304
58 Ga0207665_10007173 3300025939 Bacteria 7374
59 Ga0265324_10015516 3300029957 Bacteria 2801
60 Ga0265330_10004372 3300031235 Bacteria 7176
61 Ga0265328_10000016 3300031239 Bacteria 132959
62 Ga0265328_10000696 3300031239 Bacteria 15563
63 Ga0265328_10030527 3300031239 Bacteria 2007
64 Ga0265325_10000160 3300031241 Bacteria 47271
65 Ga0265331_10000144 3300031250 Bacteria 92791
66 Ga0265331_10000723 3300031250 Bacteria 27989
67 Ga0265331_10011046 3300031250 Bacteria 4954
68 Ga0265331_10023190 3300031250 Bacteria 3156
69 Ga0265331_10023961 3300031250 Bacteria 3093
70 Ga0265331_10026144 3300031250 Bacteria 2938
71 Ga0265327_10000314 3300031251 Bacteria 92783
72 Ga0265327_10000502 3300031251 Bacteria 67878
73 Ga0265327_10000557 3300031251 Bacteria 63857
74 Ga0265327_10002356 3300031251 Bacteria 20137
75 Ga0265327_10005483 3300031251 Bacteria 10576
76 Ga0265327_10012359 3300031251 Bacteria 5769
77 Ga0265327_10024178 3300031251 Bacteria 3576
78 Ga0265327_10056997 3300031251 Bacteria 2011
79 Ga0265316_10020547 3300031344 Bacteria 5617
80 Ga0307509_10000145 3300031507 Bacteria 107492
81 Ga0307408_100000191 3300031548 Bacteria 66129
82 Ga0307408_100000695 3300031548 Bacteria 27526
83 Ga0307408_100007462 3300031548 Bacteria 7230
84 Ga0307408_100218127 3300031548 Bacteria 1555
85 Ga0307408_100280139 3300031548 Bacteria 1388
86 Ga0316575_10004474 3300031665 Bacteria 4920
87 Ga0265314_10018037 3300031711 Bacteria 5518
88 Ga0373952_0001067 3300035092 Bacteria 5009
89 Ga0373957_0001002 3300035120 Bacteria 7425
90 Ga0373961_0005398 3300035241 Bacteria 3071
91 Ga0373924_0000903 3300035410 Bacteria 9378
92 Ga0373933_0001261 3300035724 Bacteria 14935
93 Ga0373937_0001026 3300036401 Bacteria 23613
94 Ga0316582_0095310 3300036647 Bacteria 1964
95 Ga0395899_0090954 3300037312 Bacteria 2212
96 Ga0395900_0155304 3300037418 Bacteria 2337
97 Ga0395901_0140298 3300038443 Bacteria 2540
98 Ga0451577_0000002 3300042876 Bacteria 1731375
99 Ga0451577_0005372 3300042876 Bacteria 13145
100 Ga0451577_0017667 3300042876 Bacteria 6585
101 Ga0451577_0079501 3300042876 Bacteria 2923
102 Ga0453683_0000013 3300044673 Bacteria 371932
103 Ga0453684_0000002 3300044712 Bacteria 1731375
104 Ga0453684_0000040 3300044712 Bacteria 690210
105 Ga0453684_0000638 3300044712 Bacteria 126432
106 Ga0453684_0001536 3300044712 Bacteria 64524
107 Ga0453684_0005441 3300044712 Bacteria 25215
108 Ga0453684_0163505 3300044712 Bacteria 2630
109 Ga0453684_0393809 3300044712 Bacteria 1553
110 Ga0453684_0595587 3300044712 Bacteria 1212
111 Ga0451576_0000006 3300045051 Bacteria 949698
112 Ga0451576_0000037 3300045051 Bacteria 372173
113 Ga0451576_0000140 3300045051 Bacteria 183279
114 Ga0451576_0006762 3300045051 Bacteria 13954
115 Ga0451576_0008140 3300045051 Bacteria 12351
116 Ga0451576_0008471 3300045051 Bacteria 12071
117 Ga0451576_0011427 3300045051 Bacteria 10088
118 Ga0451576_0035313 3300045051 Bacteria 5305
119 Ga0451576_0048001 3300045051 Bacteria 4487
120 Ga0451576_0067093 3300045051 Bacteria 3734
121 Ga0451576_0088691 3300045051 Bacteria 3217
122 Ga0451576_0220169 3300045051 Bacteria 1982
123 Ga0451576_0302546 3300045051 Bacteria 1673
124 Ga0495651_0001528 3300046462 Bacteria 17892
125 Ga0495583_0016905 3300046506 Bacteria 3897
126 Ga0495606_0017973 3300046507 Bacteria 5320
127 Ga0495622_0000024 3300046557 Bacteria 154056
128 Ga0495636_0016290 3300047318 Bacteria 2968
129 Ga0495675_0022949 3300047444 Bacteria 3977
130 Ga0496102_0393482 3300048905 Bacteria 1303
131 Ga0501222_003392 3300049662 Bacteria 2178
132 Ga0501227_003186 3300049665 Bacteria 3563
133 Ga0501279_001073 3300049775 Bacteria 3614
134 Ga0501279_001244 3300049775 Bacteria 3349
135 Ga0501280_000097 3300049776 Bacteria 23270
136 nmdc:mga0qj67_352819_c1 3300050509 Bacteria 1189
137 nmdc:mga08x19_20229_c1 3300050514 Bacteria 4098
138 2574433282 2574179768 Bacteria 4907129
139 2643787686 2643221554 Bacteria 6603920
140 2644213436 2643221638 Bacteria 6579467
141 2644250306 2643221645 Bacteria 7207331
142 2644357695 2643221664 Bacteria 7272945
143 2891635034 2891633521 Bacteria 4602265
144 2998344515 2998344455 Bacteria 4222996
145 Ga0265327_10062145
146 JGI25158J39367_1000207
147 JGI25158J39367_1000834
148 JGI25152J39213_1000115
149 JGI25152J39213_1011418
150 JGI25150J39212_1000197
151 JGI25150J39212_1001631
152 JGI25159J45721_1001666
153 JGI25159J45721_1005396
154 rootH2_10085593
155 JGI25160J50197_1003518
156 JGI25161J50226_1001361
157 JGI25161J50226_1001630
158 Ga0055526_1002952
159 Ga0055537_1005854
160 Ga0055524_1000801
161 Ga0055524_1001833
162 Ga0055534_1000907
163 Ga0055534_1001265
164 Ga0055530_10001212
165 Ga0055530_10004598
166 Ga0055530_10008209
167 Ga0055531_10022079
168 Ga0055531_10031945
169 Ga0055543_1001293
170 Ga0065165_1000507
171 Ga0065714_10029215
172 Ga0070716_100004507
173 Ga0075436_100023188
174 Ga0105240_10251357
175 Ga0209436_100730
176 Ga0209436_101571
177 Ga0207425_1000006
178 Ga0207425_1000105
179 Ga0209129_1000090
180 Ga0209129_1011380
181 Ga0209565_1000680
182 Ga0209565_1000748
183 Ga0209565_1001068
184 Ga0209565_1004302
185 Ga0209673_1007971
186 Ga0209130_1000298
187 Ga0209130_1005105
188 Ga0209675_1001569
189 Ga0209675_1001772
190 Ga0209564_1000513
191 Ga0209564_1011056
192 Ga0209758_1000047
193 Ga0209050_1000085
194 Ga0209050_1000984
195 Ga0209050_1001090
196 Ga0209256_1000080
197 Ga0209256_1003079
198 Ga0209256_1004617
199 Ga0207426_1004267
200 Ga0209257_1000010
201 Ga0209257_1004253
202 Ga0207665_10007173
203 Ga0265324_10015516
204 Ga0265330_10004372
205 Ga0265328_10000016
206 Ga0265328_10000696
207 Ga0265328_10030527
208 Ga0265325_10000160
209 Ga0265331_10000144
210 Ga0265331_10000723
211 Ga0265331_10011046
212 Ga0265331_10023190
213 Ga0265331_10023961
214 Ga0265331_10026144
215 Ga0265327_10000314
216 Ga0265327_10000502
217 Ga0265327_10000557
218 Ga0265327_10002356
219 Ga0265327_10005483
220 Ga0265327_10012359
221 Ga0265327_10024178
222 Ga0265327_10056997
223 Ga0265316_10020547
224 Ga0307509_10000145
225 Ga0307408_100000191
226 Ga0307408_100000695
227 Ga0307408_100007462
228 Ga0307408_100218127
229 Ga0307408_100280139
230 Ga0316575_10004474
231 Ga0265314_10018037
232 Ga0373952_0001067
233 Ga0373957_0001002
234 Ga0373961_0005398
235 Ga0373924_0000903
236 Ga0373933_0001261
237 Ga0373937_0001026
238 Ga0316582_0095310
239 Ga0395899_0090954
240 Ga0395900_0155304
241 Ga0395901_0140298
242 Ga0451577_0000002
243 Ga0451577_0005372
244 Ga0451577_0017667
245 Ga0451577_0079501
246 Ga0453683_0000013
247 Ga0453684_0000002
248 Ga0453684_0000040
249 Ga0453684_0000638
250 Ga0453684_0001536
251 Ga0453684_0005441
252 Ga0453684_0163505
253 Ga0453684_0393809
254 Ga0453684_0595587
255 Ga0451576_0000006
256 Ga0451576_0000037
257 Ga0451576_0000140
258 Ga0451576_0006762
259 Ga0451576_0008140
260 Ga0451576_0008471
261 Ga0451576_0011427
262 Ga0451576_0035313
263 Ga0451576_0048001
264 Ga0451576_0067093
265 Ga0451576_0088691
266 Ga0451576_0220169
267 Ga0451576_0302546
268 Ga0495651_0001528
269 Ga0495583_0016905
270 Ga0495606_0017973
271 Ga0495622_0000024
272 Ga0495636_0016290
273 Ga0495675_0022949
274 Ga0496102_0393482
275 Ga0501222_003392
276 Ga0501227_003186
277 Ga0501279_001073
278 Ga0501279_001244
279 Ga0501280_000097
280 nmdc:mga0qj67_352819_c1
281 nmdc:mga08x19_20229_c1
282 2574433282
283 2643787686
284 2644213436
285 2644250306
286 2644357695
287 2891635034
288 2998344515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02424

ApbE

ApbE family

72

398

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vrm-assembly1.cif.gz_A crystal structure of the apbe protein (tm1553) from thermotoga maritima msb8 at 1.58 a resolution 0.9159 25 336
7esb-assembly1.cif.gz_A fmnb complexed with atp 0.9148 23 337
1vrm-assembly1.cif.gz_A crystal structure of the apbe protein (tm1553) from thermotoga maritima msb8 at 1.58 a resolution 0.913 25 336
7f2u-assembly2.cif.gz_B fmnb complexed with adp 0.9091 21 337
4ifw-assembly1.cif.gz_A crystal structure of treponema pallidum tp0796 flavin trafficking protein, adp inhibited form 0.8902 23 336
ID Description Score Start End Superfamily
1vrmA02 Mainly Alpha;Orthogonal Bundle;T-fold;ApbE-like superfamily 0.89 74 172 1.10.3980.10
1vrmA01 Alpha Beta;Roll;T-fold;ApbE-like domains 0.8849 25 336 3.10.520.10
1vrmA01 Alpha Beta;Roll;T-fold;ApbE-like domains 0.8808 25 336 3.10.520.10
6nxjB00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.8765 25 333 3.10.520.10
6nxjB00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.8681 25 333 3.10.520.10
ID Description Score Start End GO Terms
AF-A0A349KVG9-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9895 65 340 GO:0016740
GO:0046872
AF-A0A3D6AJF5-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9873 20 333 GO:0016740
GO:0046872
AF-A0A349KVG9-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9825 65 340 GO:0016740
GO:0046872
AF-A0A6A8VZG7-F1-model_v4 deleted 0.98 16 333
AF-A0A6L5DF11-F1-model_v4 deleted 0.9772 30 336

Map