F192106

General Info

Members Datasets Scaffolds Average Seq Length
144 89 288 459

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10000865|Ga0265324_100008655
Length 475
Sequence MAEACGAEIIGGAADVEVKAVCTDSRLAKAGDLFFAIKGDKFDGHNFAAEVAVKGVAAIVVESKKVPTFVLNCPLLTVKDVRAALGKLAAAHRREFALPVIAVGGSNGKTTVKELLASVLRQKFPTLASEASFNNDIGVPMTLLRLETFHQAAVLEAGTNHPGELAPLLKMIAPKIGVITSIGREHLEFFGDVAGVAQEEGWLAELLPADGKLFLNGDSEWSDKIAARTKAQVVRVGFGEKNDWCAKKVRLDKNGVTFQVVAEASRLCVSEDVGSPNELTGGTPVPLAKFAGEYRVNLLGKHQAVNSLLAIAVGAELGLTREQILRGLAECQPAKMRLNFWEANGVRVLDDSYNANADSTIAALETLCGLPLQGRRVAVLGDMAELGAHSAAAHAEVGRRAAELEVGQLFAVGKMAVVTAQAARDAGLMRVFEFAEVEAAMNVVRSFLKPGDVVLLKASRAAKLEQIAEMLKAGK

Samples

Sample ID Description Type Environment
1 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
21 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
28 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
29 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
30 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
31 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
34 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
35 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
36 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
42 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
43 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
44 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
45 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
46 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
47 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
48 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
49 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
50 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
51 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
54 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
55 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
56 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
57 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
58 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
59 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
60 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
61 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
62 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
66 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
67 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
68 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
72 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
73 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
74 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.78
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265324_10000865 3300029957 Bacteria 19451
2 rootH1_10147535 3300003323 Bacteria 2950
3 Ga0070690_100013712 3300005330 Bacteria 4799
4 Ga0070689_100016200 3300005340 Bacteria 5450
5 Ga0070714_100035491 3300005435 Bacteria 4180
6 Ga0070711_100002309 3300005439 Bacteria 10823
7 Ga0070708_100045651 3300005445 Bacteria 3861
8 Ga0070685_10073080 3300005466 Bacteria 2037
9 Ga0070686_100081517 3300005544 Bacteria 2143
10 Ga0068855_100060216 3300005563 Bacteria 4441
11 Ga0068857_100043616 3300005577 Bacteria 3978
12 Ga0068859_100020422 3300005617 Bacteria 6648
13 Ga0068863_100023787 3300005841 Bacteria 5846
14 Ga0075430_100056764 3300006846 Bacteria 3293
15 Ga0075431_100008485 3300006847 Bacteria 10289
16 Ga0097620_100020422 3300006931 Bacteria 6648
17 Ga0111539_10122630 3300009094 Bacteria 3046
18 Ga0111539_10198868 3300009094 Bacteria 2338
19 Ga0105238_10150627 3300009551 Bacteria 2301
20 Ga0157374_10017540 3300013296 Bacteria 6306
21 Ga0163163_10000194 3300014325 Bacteria 62568
22 Ga0207663_10001297 3300025916 Bacteria 11584
23 Ga0207664_10013839 3300025929 Bacteria 5809
24 Ga0207670_10005501 3300025936 Bacteria 6963
25 Ga0207667_10189327 3300025949 Bacteria 2111
26 Ga0207667_10229433 3300025949 Bacteria 1902
27 Ga0207702_10002497 3300026078 Bacteria 17366
28 Ga0207641_10019516 3300026088 Bacteria 5565
29 Ga0265337_1000077 3300028556 Bacteria 46215
30 Ga0265337_1001501 3300028556 Bacteria 11453
31 Ga0265337_1013615 3300028556 Bacteria 2722
32 Ga0265326_10006080 3300028558 Bacteria 3772
33 Ga0265319_1000004 3300028563 Bacteria 305085
34 Ga0265323_10000058 3300028653 Bacteria 61416
35 Ga0265336_10001988 3300028666 Bacteria 8733
36 Ga0265338_10000038 3300028800 Bacteria 237195
37 Ga0265338_10000214 3300028800 Bacteria 106870
38 Ga0265338_10000276 3300028800 Bacteria 93585
39 Ga0265338_10000439 3300028800 Bacteria 74770
40 Ga0265338_10000533 3300028800 Bacteria 66710
41 Ga0265338_10000843 3300028800 Bacteria 51673
42 Ga0265338_10001209 3300028800 Bacteria 42710
43 Ga0265338_10003168 3300028800 Bacteria 23481
44 Ga0265338_10004206 3300028800 Bacteria 19630
45 Ga0265338_10004557 3300028800 Bacteria 18651
46 Ga0265338_10005205 3300028800 Bacteria 17062
47 Ga0265338_10007101 3300028800 Bacteria 14031
48 Ga0265338_10010977 3300028800 Bacteria 10526
49 Ga0265338_10042086 3300028800 Bacteria 4261
50 Ga0265338_10074868 3300028800 Unclassified 2876
51 Ga0265338_10094003 3300028800 Unclassified 2468
52 Ga0265338_10121659 3300028800 Bacteria 2079
53 Ga0265338_10125838 3300028800 Bacteria 2034
54 Ga0265338_10161301 3300028800 Bacteria 1731
55 Ga0265324_10000237 3300029957 Bacteria 41672
56 Ga0265324_10021451 3300029957 Bacteria 2315
57 Ga0265320_10000242 3300031240 Bacteria 45162
58 Ga0265320_10000364 3300031240 Bacteria 36776
59 Ga0265320_10027643 3300031240 Bacteria 2955
60 Ga0265320_10030268 3300031240 Bacteria 2793
61 Ga0265325_10007970 3300031241 Bacteria 6287
62 Ga0265325_10013206 3300031241 Bacteria 4706
63 Ga0265325_10043243 3300031241 Bacteria 2351
64 Ga0265340_10000246 3300031247 Bacteria 28156
65 Ga0265339_10013546 3300031249 Bacteria 4938
66 Ga0265339_10019883 3300031249 Bacteria 3931
67 Ga0265327_10001439 3300031251 Bacteria 30023
68 Ga0265327_10028996 3300031251 Bacteria 3154
69 Ga0265316_10001480 3300031344 Bacteria 25164
70 Ga0265316_10005378 3300031344 Bacteria 12458
71 Ga0265316_10007636 3300031344 Bacteria 10157
72 Ga0265316_10045469 3300031344 Bacteria 3484
73 Ga0265316_10208314 3300031344 Bacteria 1447
74 Ga0265313_10004915 3300031595 Bacteria 10017
75 Ga0265313_10013895 3300031595 Bacteria 4795
76 Ga0265314_10061643 3300031711 Bacteria 2552
77 Ga0265314_10087284 3300031711 Bacteria 2040
78 Ga0307516_10012783 3300031730 Bacteria 9022
79 Ga0373928_0000416 3300035084 Bacteria 8506
80 Ga0373929_0001756 3300035085 Bacteria 4076
81 Ga0373944_0000468 3300035089 Bacteria 9365
82 Ga0373949_0001180 3300035090 Bacteria 7756
83 Ga0373951_0005684 3300035091 Bacteria 2886
84 Ga0373932_0000001 3300035112 Bacteria 1459067
85 Ga0373955_0105286 3300035172 Bacteria 1625
86 Ga0373931_0000004 3300035691 Bacteria 535140
87 Ga0373935_0013243 3300035692 Unclassified 4975
88 Ga0373927_0050804 3300035695 Bacteria 2681
89 Ga0373937_0044743 3300036401 Bacteria 4044
90 Ga0373925_0001025 3300037068 Bacteria 25280
91 Ga0373925_0009077 3300037068 Bacteria 7239
92 Ga0453684_0005468 3300044712 Bacteria 25149
93 Ga0451576_0029710 3300045051 Bacteria 5847
94 Ga0451576_0030294 3300045051 Bacteria 5784
95 Ga0451576_0036357 3300045051 Bacteria 5221
96 Ga0451576_0068329 3300045051 Bacteria 3698
97 Ga0451576_0082396 3300045051 Bacteria 3346
98 Ga0451576_0255292 3300045051 Unclassified 1832
99 Ga0495592_0000101 3300046454 Bacteria 75856
100 Ga0495662_0010829 3300046476 Bacteria 4460
101 Ga0495662_0035515 3300046476 Bacteria 2405
102 Ga0495618_0001806 3300046514 Bacteria 14162
103 Ga0495618_0048545 3300046514 Bacteria 2680
104 Ga0495628_0001655 3300046516 Bacteria 20382
105 Ga0495630_0000073 3300046517 Bacteria 79321
106 Ga0495630_0012740 3300046517 Bacteria 6108
107 Ga0495630_0036449 3300046517 Bacteria 3677
108 Ga0495630_0081594 3300046517 Bacteria 2440
109 Ga0495630_0129468 3300046517 Unclassified 1916
110 Ga0495666_0001768 3300046526 Bacteria 10663
111 Ga0495666_0016212 3300046526 Unclassified 3711
112 Ga0495652_0053992 3300046529 Bacteria 3423
113 Ga0495640_0015495 3300046533 Bacteria 5734
114 Ga0495586_0000040 3300046535 Bacteria 79335
115 Ga0495586_0000348 3300046535 Bacteria 29056
116 Ga0495645_0008072 3300046543 Bacteria 7335
117 Ga0495622_0021147 3300046557 Bacteria 3031
118 Ga0495634_0008406 3300046642 Bacteria 7691
119 Ga0495599_0016519 3300046678 Bacteria 4583
120 Ga0495613_0008133 3300046689 Bacteria 7802
121 Ga0495624_0113284 3300046690 Bacteria 1667
122 Ga0495674_0002615 3300047319 Bacteria 17520
123 Ga0495674_0006476 3300047319 Bacteria 11226
124 Ga0495676_0006224 3300047321 Bacteria 10981
125 Ga0495677_0032178 3300047445 Bacteria 1910
126 Ga0495684_0068370 3300047471 Unclassified 2701
127 Ga0496104_0038861 3300048907 Bacteria 4454
128 Ga0496114_0006736 3300048917 Bacteria 9050
129 Ga0496115_0006113 3300048918 Bacteria 8799
130 Ga0496115_0065103 3300048918 Bacteria 2944
131 Ga0501031_0018937 3300049568 Bacteria 4482
132 Ga0501032_0005152 3300049569 Bacteria 9747
133 Ga0501033_0011982 3300049570 Bacteria 6622
134 Ga0501033_0054317 3300049570 Bacteria 2964
135 Ga0501036_0190233 3300049572 Bacteria 1727
136 Ga0501037_0100573 3300049573 Bacteria 2087
137 Ga0501043_0149135 3300049579 Bacteria 1830
138 Ga0501046_0054762 3300049580 Bacteria 3137
139 Ga0501047_0226309 3300049581 Bacteria 1725
140 Ga0501070_0248403 3300049586 Bacteria 1456
141 Ga0501044_0001072 3300049823 Bacteria 32802
142 Ga0501044_0029088 3300049823 Bacteria 5827
143 nmdc:mga06r32_118898_c1 3300050510 Unclassified 2606
144 nmdc:mga08y16_165077_c1 3300050511 Bacteria 2300
145 Ga0265324_10000865
146 rootH1_10147535
147 Ga0070690_100013712
148 Ga0070689_100016200
149 Ga0070714_100035491
150 Ga0070711_100002309
151 Ga0070708_100045651
152 Ga0070685_10073080
153 Ga0070686_100081517
154 Ga0068855_100060216
155 Ga0068857_100043616
156 Ga0068859_100020422
157 Ga0068863_100023787
158 Ga0075430_100056764
159 Ga0075431_100008485
160 Ga0097620_100020422
161 Ga0111539_10122630
162 Ga0111539_10198868
163 Ga0105238_10150627
164 Ga0157374_10017540
165 Ga0163163_10000194
166 Ga0207663_10001297
167 Ga0207664_10013839
168 Ga0207670_10005501
169 Ga0207667_10189327
170 Ga0207667_10229433
171 Ga0207702_10002497
172 Ga0207641_10019516
173 Ga0265337_1000077
174 Ga0265337_1001501
175 Ga0265337_1013615
176 Ga0265326_10006080
177 Ga0265319_1000004
178 Ga0265323_10000058
179 Ga0265336_10001988
180 Ga0265338_10000038
181 Ga0265338_10000214
182 Ga0265338_10000276
183 Ga0265338_10000439
184 Ga0265338_10000533
185 Ga0265338_10000843
186 Ga0265338_10001209
187 Ga0265338_10003168
188 Ga0265338_10004206
189 Ga0265338_10004557
190 Ga0265338_10005205
191 Ga0265338_10007101
192 Ga0265338_10010977
193 Ga0265338_10042086
194 Ga0265338_10074868
195 Ga0265338_10094003
196 Ga0265338_10121659
197 Ga0265338_10125838
198 Ga0265338_10161301
199 Ga0265324_10000237
200 Ga0265324_10021451
201 Ga0265320_10000242
202 Ga0265320_10000364
203 Ga0265320_10027643
204 Ga0265320_10030268
205 Ga0265325_10007970
206 Ga0265325_10013206
207 Ga0265325_10043243
208 Ga0265340_10000246
209 Ga0265339_10013546
210 Ga0265339_10019883
211 Ga0265327_10001439
212 Ga0265327_10028996
213 Ga0265316_10001480
214 Ga0265316_10005378
215 Ga0265316_10007636
216 Ga0265316_10045469
217 Ga0265316_10208314
218 Ga0265313_10004915
219 Ga0265313_10013895
220 Ga0265314_10061643
221 Ga0265314_10087284
222 Ga0307516_10012783
223 Ga0373928_0000416
224 Ga0373929_0001756
225 Ga0373944_0000468
226 Ga0373949_0001180
227 Ga0373951_0005684
228 Ga0373932_0000001
229 Ga0373955_0105286
230 Ga0373931_0000004
231 Ga0373935_0013243
232 Ga0373927_0050804
233 Ga0373937_0044743
234 Ga0373925_0001025
235 Ga0373925_0009077
236 Ga0453684_0005468
237 Ga0451576_0029710
238 Ga0451576_0030294
239 Ga0451576_0036357
240 Ga0451576_0068329
241 Ga0451576_0082396
242 Ga0451576_0255292
243 Ga0495592_0000101
244 Ga0495662_0010829
245 Ga0495662_0035515
246 Ga0495618_0001806
247 Ga0495618_0048545
248 Ga0495628_0001655
249 Ga0495630_0000073
250 Ga0495630_0012740
251 Ga0495630_0036449
252 Ga0495630_0081594
253 Ga0495630_0129468
254 Ga0495666_0001768
255 Ga0495666_0016212
256 Ga0495652_0053992
257 Ga0495640_0015495
258 Ga0495586_0000040
259 Ga0495586_0000348
260 Ga0495645_0008072
261 Ga0495622_0021147
262 Ga0495634_0008406
263 Ga0495599_0016519
264 Ga0495613_0008133
265 Ga0495624_0113284
266 Ga0495674_0002615
267 Ga0495674_0006476
268 Ga0495676_0006224
269 Ga0495677_0032178
270 Ga0495684_0068370
271 Ga0496104_0038861
272 Ga0496114_0006736
273 Ga0496115_0006113
274 Ga0496115_0065103
275 Ga0501031_0018937
276 Ga0501032_0005152
277 Ga0501033_0011982
278 Ga0501033_0054317
279 Ga0501036_0190233
280 Ga0501037_0100573
281 Ga0501043_0149135
282 Ga0501046_0054762
283 Ga0501047_0226309
284 Ga0501070_0248403
285 Ga0501044_0001072
286 Ga0501044_0029088
287 nmdc:mga06r32_118898_c1
288 nmdc:mga08y16_165077_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08245

Mur_ligase_M

Mur ligase middle domain

103

314

0.93

PF01225

Mur_ligase

Mur ligase family, catalytic domain

17

93

0.87

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

336

460

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f5d-assembly1.cif.gz_A architecture of the mure-murf ligase bacterial cell wall biosynthesis complex 0.9232 21 315
4qf5-assembly2.cif.gz_B crystal structure i of murf from acinetobacter baumannii 0.9181 2 453
3zl8-assembly1.cif.gz_A crystal structure of murf ligase from thermotoga maritima in complex with adp 0.8953 21 453
4qf5-assembly2.cif.gz_B crystal structure i of murf from acinetobacter baumannii 0.8948 2 453
4ziy-assembly1.cif.gz_A structure of udp-n-acetylmuramoylalanyl-d-glutamyl-2,6-diaminopimelate--d-alanyl-d-alanyl ligase from acinetobacter baumannii 0.8833 2 454
ID Description Score Start End Superfamily
af_P9WJL1_108_337_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9565 86 310 3.40.1190.10
af_Q2FWH4_87_313_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9452 85 314 3.40.1190.10
3zl8A01 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;MurE/MurF, N-terminal domain 0.9443 22 66 3.40.1390.10
4ziyA02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9397 85 314 3.40.1190.10
af_Q2FWH4_87_313_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9372 85 314 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A832HQK4-F1-model_v4 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (EC 6.3.2.10) (D-alanyl-D-alanine-adding enzyme) 0.9783 4 455 GO:0005524
GO:0005737
GO:0008360
GO:0009252
GO:0047480
GO:0051301
GO:0071555
AF-A0A2E7SS03-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9767 1 338 GO:0005524
GO:0008360
GO:0009252
GO:0047480
GO:0051301
GO:0071555
AF-A0A536ZT79-F1-model_v4 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 0.9752 83 233 GO:0005524
GO:0009058
GO:0016881
AF-A0A0S7X795-F1-model_v4 Mur ligase C-terminal domain-containing protein 0.9737 320 453 GO:0009058
GO:0016881
AF-A0A532E6N0-F1-model_v4 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (EC 6.3.2.10) 0.972 83 453 GO:0005524
GO:0005737
GO:0008360
GO:0008766
GO:0009252
GO:0047480
GO:0051301
GO:0071555

Map