F191950

General Info

Members Datasets Scaffolds Average Seq Length
144 99 144 133

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10271178|Ga0207712_102711782
Length 145
Sequence LYDLSAATLMSYVHETQVRVRYGETDQMGFVYYGVYAQYYEVARVEAMRDLGILYADLERLHHIWMPVTHMEVRYLRPARYDDLLTIKTTVPTLPGKEIRFRYEICNEAGDLLNGAMVKLCFLDSRTQQRILAPEFITDPLKLYF

Samples

Sample ID Description Type Environment
1 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
57 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
58 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
62 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
63 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
64 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
65 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
76 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
77 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
78 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
79 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
80 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
81 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
82 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
83 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
84 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
85 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
86 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
87 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
88 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
89 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
92 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
93 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
94 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
95 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
96 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
97 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
98 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
99 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.89
Nodule 0
Rhizoplane 4.17
Rhizosphere 64.58
Stem 0
Stem Tuber 0
Unclassified 17.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10003170 3300003316 Bacteria 1693
2 rootH2_10052352 3300003320 Bacteria 26383
3 rootH2_10177077 3300003320 Bacteria 1041
4 rootL2_10028130 3300003322 Unclassified 2676
5 rootL2_10138530 3300003322 Bacteria 2793
6 rootL2_10189598 3300003322 Unclassified 1262
7 rootL2_10218261 3300003322 Unclassified 4654
8 rootL2_10284193 3300003322 Bacteria 1190
9 rootL2_10327740 3300003322 Bacteria 1401
10 rootH1_10002623 3300003316 Bacteria 12699
11 rootH1_10002623 3300003323 Bacteria 7256
12 rootH1_10038890 3300003323 Bacteria 6513
13 rootH1_10049386 3300003323 Unclassified 2239
14 rootH1_10049847 3300003323 Unclassified 2874
15 rootH1_10173457 3300003323 Unclassified 1263
16 Ga0055531_10001109 3300003794 Bacteria 20940
17 Ga0065165_1001170 3300005262 Bacteria 30482
18 Ga0070690_100893260 3300005330 Bacteria 694
19 Ga0070690_101241519 3300005330 Bacteria 595
20 Ga0070689_100894891 3300005340 Bacteria 785
21 Ga0070671_100790355 3300005355 Bacteria 826
22 Ga0070714_100043997 3300005435 Bacteria 3779
23 Ga0070694_100650420 3300005444 Unclassified 853
24 Ga0068867_100772590 3300005459 Bacteria 854
25 Ga0070665_100978005 3300005548 Unclassified 859
26 Ga0068856_101667004 3300005614 Bacteria 650
27 Ga0068864_100053732 3300005618 Bacteria 3476
28 Ga0068864_100420533 3300005618 Bacteria 1273
29 Ga0068851_10000924 3300005834 Bacteria 12670
30 Ga0068870_11448277 3300005840 Unclassified 504
31 Ga0070717_10626219 3300006028 Bacteria 976
32 Ga0075366_10597179 3300006195 Bacteria 684
33 Ga0075366_10600530 3300006195 Unclassified 682
34 Ga0097621_101457293 3300006237 Bacteria 649
35 Ga0075428_100042190 3300006844 Bacteria 5017
36 Ga0075430_100054812 3300006846 Bacteria 3354
37 Ga0105240_10891324 3300009093 Bacteria 958
38 Ga0111539_10022198 3300009094 Bacteria 7803
39 Ga0111539_10035488 3300009094 Bacteria 6037
40 Ga0111539_11534721 3300009094 Unclassified 772
41 Ga0111539_12003127 3300009094 Unclassified 672
42 Ga0105242_12226135 3300009176 Bacteria 594
43 Ga0105249_10176277 3300009553 Bacteria 2077
44 Ga0105249_10597237 3300009553 Bacteria 1158
45 Ga0157370_10237742 3300013104 Bacteria 1686
46 Ga0157372_10580995 3300013307 Bacteria 1306
47 Ga0157380_10000106 3300014326 Bacteria 45671
48 Ga0157380_10001555 3300014326 Bacteria 15095
49 Ga0157376_11635812 3300014969 Bacteria 679
50 Ga0209050_1008791 3300025298 Bacteria 5306
51 Ga0209257_1000007 3300025304 Bacteria 1564415
52 Ga0209257_1138027 3300025304 Bacteria 551
53 Ga0207656_10000126 3300025321 Bacteria 29065
54 Ga0207695_10610022 3300025913 Bacteria 972
55 Ga0207700_10311923 3300025928 Bacteria 1361
56 Ga0207664_10051361 3300025929 Bacteria 3255
57 Ga0207644_10535201 3300025931 Bacteria 969
58 Ga0207670_10796813 3300025936 Bacteria 787
59 Ga0207667_10290510 3300025949 Bacteria 1670
60 Ga0207712_10271178 3300025961 Bacteria 1380
61 Ga0207702_10179346 3300026078 Bacteria 1949
62 Ga0207648_10842115 3300026089 Bacteria 855
63 Ga0207676_10277374 3300026095 Bacteria 1520
64 Ga0207676_10400899 3300026095 Bacteria 1282
65 Ga0207674_10082733 3300026116 Bacteria 3210
66 Ga0207428_10023235 3300027907 Bacteria 5216
67 Ga0207428_10025541 3300027907 Bacteria 4945
68 Ga0268266_10849527 3300028379 Unclassified 882
69 Ga0307515_10000094 3300028794 Bacteria 210723
70 Ga0307515_10150631 3300028794 Bacteria 2433
71 Ga0307515_10225346 3300028794 Bacteria 1681
72 Ga0307513_10044626 3300031456 Bacteria 4854
73 Ga0307513_10270472 3300031456 Bacteria 1483
74 Ga0307509_10207430 3300031507 Bacteria 1788
75 Ga0307509_10272468 3300031507 Bacteria 1459
76 Ga0307509_10482053 3300031507 Bacteria 928
77 Ga0307408_100106165 3300031548 Bacteria 2148
78 Ga0307514_10058279 3300031649 Bacteria 2955
79 Ga0316576_10090517 3300031727 Bacteria 2279
80 Ga0316576_10115617 3300031727 Bacteria 2013
81 Ga0316576_10119894 3300031727 Bacteria 1975
82 Ga0307413_12092297 3300031824 Bacteria 512
83 Ga0307406_10673774 3300031901 Bacteria 861
84 Ga0316574_0023686 3300035398 Bacteria 3668
85 Ga0373927_0007295 3300035695 Bacteria 7499
86 Ga0373933_0121707 3300035724 Bacteria 1635
87 Ga0316584_0097264 3300036712 Bacteria 2204
88 Ga0395905_0000003 3300037471 Bacteria 1347396
89 Ga0451791_1368827 3300041451 Bacteria 558
90 Ga0451798_0231232 3300041458 Bacteria 799
91 Ga0451798_0813684 3300041458 Bacteria 677
92 Ga0451800_0487569 3300041459 Bacteria 735
93 Ga0451807_0069373 3300041486 Bacteria 616
94 Ga0451807_2547403 3300041486 Bacteria 535
95 Ga0451837_0364600 3300041494 Bacteria 648
96 Ga0451837_1427478 3300041494 Bacteria 821
97 Ga0451577_0065032 3300042876 Bacteria 3252
98 Ga0451577_0698293 3300042876 Bacteria 919
99 Ga0453683_0019003 3300044673 Bacteria 4407
100 Ga0466964_0011353 3300044706 Bacteria 3364
101 Ga0453684_0004423 3300044712 Bacteria 29681
102 Ga0453684_0600008 3300044712 Bacteria 1207
103 Ga0453684_0617016 3300044712 Bacteria 1187
104 Ga0453684_0728252 3300044712 Bacteria 1075
105 Ga0466957_1013730 3300044842 Bacteria 597
106 Ga0451576_0015202 3300045051 Bacteria 8539
107 Ga0451576_0055897 3300045051 Bacteria 4128
108 Ga0495638_0000004 3300046460 Bacteria 700795
109 Ga0495664_0827152 3300046477 Unclassified 544
110 Ga0495625_0084874 3300046660 Bacteria 2199
111 Ga0501290_021044 3300049513 Bacteria 893
112 Ga0501068_0368039 3300049584 Bacteria 925
113 Ga0501207_027194 3300049654 Bacteria 946
114 Ga0501217_003128 3300049661 Bacteria 3318
115 Ga0501222_018625 3300049662 Bacteria 924
116 Ga0501236_000137 3300049670 Bacteria 7301
117 Ga0501242_000082 3300049674 Bacteria 6154
118 Ga0501242_030185 3300049674 Bacteria 731
119 Ga0501243_045833 3300049675 Bacteria 778
120 Ga0501243_074645 3300049675 Bacteria 650
121 Ga0501247_000241 3300049677 Bacteria 3804
122 Ga0501257_001079 3300049686 Bacteria 5528
123 Ga0501257_008546 3300049686 Unclassified 2303
124 Ga0501257_033237 3300049686 Bacteria 1249
125 Ga0501221_122959 3300049704 Bacteria 665
126 Ga0501225_0026040 3300049705 Unclassified 1609
127 Ga0501264_000291 3300049761 Bacteria 7866
128 Ga0501226_017810 3300049853 Bacteria 781
129 nmdc:mga0qj67_66906_c1 3300050509 Bacteria 2862
130 nmdc:mga08y16_4813_c1 3300050511 Bacteria 14083
131 nmdc:mga08y16_95252_c1 3300050511 Bacteria 3101
132 Ga0500646_0102533 3300053090 Unclassified 900
133 Ga0500651_0217464 3300053093 Bacteria 1122
134 Ga0500556_0003187 3300053104 Bacteria 4889
135 Ga0500557_000631 3300053105 Bacteria 4843
136 Ga0500652_327486 3300053131 Bacteria 585
137 Ga0500655_007658 3300053133 Unclassified 1945
138 Ga0500604_0004905 3300053151 Bacteria 3548
139 Ga0500616_0000015 3300053153 Bacteria 633259
140 Ga0500616_0019906 3300053153 Bacteria 3775
141 Ga0500616_0099205 3300053153 Unclassified 1427
142 Ga0500622_0000063 3300053156 Bacteria 127587
143 Ga0500622_0000893 3300053156 Bacteria 25413
144 Ga0500622_0010278 3300053156 Bacteria 5143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049704 Ga0501221_122959 Ga0501221_122959_22_351 108
2 3300049705 Ga0501225_0026040 Ga0501225_0026040_17_346 108
3 3300041451 Ga0451791_1368827 Ga0451791_1368827_76_426 116
4 3300013307 Ga0157372_10580995 Ga0157372_105809952 118
5 3300031901 Ga0307406_10673774 Ga0307406_106737742 118
6 3300041459 Ga0451800_0487569 Ga0451800_0487569_282_638 118
7 3300045051 Ga0451576_0055897 Ga0451576_0055897_2126_2485 118
8 3300046660 Ga0495625_0084874 Ga0495625_0084874_1380_1736 118
9 3300049513 Ga0501290_021044 Ga0501290_021044_219_578 118
10 3300049654 Ga0501207_027194 Ga0501207_027194_110_469 118
11 3300049661 Ga0501217_003128 Ga0501217_003128_754_1110 118
12 3300049662 Ga0501222_018625 Ga0501222_018625_131_490 118
13 3300049674 Ga0501242_000082 Ga0501242_000082_1695_2054 118
14 3300049675 Ga0501243_074645 Ga0501243_074645_256_615 118
15 3300049677 Ga0501247_000241 Ga0501247_000241_2645_3001 118
16 3300049686 Ga0501257_008546 Ga0501257_008546_1164_1523 118
17 3300049686 Ga0501257_033237 Ga0501257_033237_815_1171 118
18 3300049853 Ga0501226_017810 Ga0501226_017810_34_390 118
19 3300053090 Ga0500646_0102533 Ga0500646_0102533_527_883 118
20 3300041494 Ga0451837_0364600 Ga0451837_0364600_39_413 124
21 iso_pu_bacteria 2896344016 2896346789 131
22 3300005614 Ga0068856_101667004 Ga0068856_1016670041 134
23 3300005834 Ga0068851_10000924 Ga0068851_100009242 134
24 3300006195 Ga0075366_10597179 Ga0075366_105971792 134
25 3300009094 Ga0111539_12003127 Ga0111539_120031271 134
26 3300009553 Ga0105249_10176277 Ga0105249_101762772 134
27 3300009553 Ga0105249_10597237 Ga0105249_105972371 134
28 3300014326 Ga0157380_10000106 Ga0157380_1000010625 134
29 3300025321 Ga0207656_10000126 Ga0207656_1000012620 134
30 3300025961 Ga0207712_10271178 Ga0207712_102711782 134
31 3300026078 Ga0207702_10179346 Ga0207702_101793461 134
32 3300026116 Ga0207674_10082733 Ga0207674_100827333 134
33 3300028794 Ga0307515_10225346 Ga0307515_102253462 134
34 3300037471 Ga0395905_0000003 Ga0395905_0000003_185632_186036 134
35 3300041486 Ga0451807_2547403 Ga0451807_2547403_63_467 134
36 3300049584 Ga0501068_0368039 Ga0501068_0368039_173_577 134
37 3300053133 Ga0500655_007658 Ga0500655_007658_294_698 134
38 3300053151 Ga0500604_0004905 Ga0500604_0004905_1294_1698 134
39 3300053156 Ga0500622_0000063 Ga0500622_0000063_9514_9918 134
40 3300053156 Ga0500622_0000893 Ga0500622_0000893_9508_9912 134
41 3300003316 rootH1_10003170 rootH1_100031702 135
42 3300003320 rootH2_10052352 rootH2_1005235216 135
43 3300003320 rootH2_10177077 rootH2_101770772 135
44 3300003322 rootL2_10028130 rootL2_100281302 135
45 3300003322 rootL2_10138530 rootL2_101385303 135
46 3300003322 rootL2_10189598 rootL2_101895982 135
47 3300003322 rootL2_10218261 rootL2_102182612 135
48 3300003322 rootL2_10284193 rootL2_102841931 135
49 3300003322 rootL2_10327740 rootL2_103277402 135
50 3300003323 rootH1_10002623 rootH1_100026232 135
51 3300003323 rootH1_10038890 rootH1_100388905 135
52 3300003323 rootH1_10049386 rootH1_100493862 135
53 3300003323 rootH1_10049847 rootH1_100498473 135
54 3300003323 rootH1_10173457 rootH1_101734572 135
55 3300003794 Ga0055531_10001109 Ga0055531_100011095 135
56 3300005262 Ga0065165_1001170 Ga0065165_100117022 135
57 3300005330 Ga0070690_100893260 Ga0070690_1008932602 135
58 3300005330 Ga0070690_101241519 Ga0070690_1012415191 135
59 3300005340 Ga0070689_100894891 Ga0070689_1008948911 135
60 3300005355 Ga0070671_100790355 Ga0070671_1007903552 135
61 3300005435 Ga0070714_100043997 Ga0070714_1000439971 135
62 3300005444 Ga0070694_100650420 Ga0070694_1006504202 135
63 3300005459 Ga0068867_100772590 Ga0068867_1007725902 135
64 3300005548 Ga0070665_100978005 Ga0070665_1009780052 135
65 3300005618 Ga0068864_100053732 Ga0068864_1000537322 135
66 3300005618 Ga0068864_100420533 Ga0068864_1004205332 135
67 3300005840 Ga0068870_11448277 Ga0068870_114482771 135
68 3300006028 Ga0070717_10626219 Ga0070717_106262192 135
69 3300006195 Ga0075366_10600530 Ga0075366_106005302 135
70 3300006237 Ga0097621_101457293 Ga0097621_1014572931 135
71 3300006844 Ga0075428_100042190 Ga0075428_1000421906 135
72 3300006846 Ga0075430_100054812 Ga0075430_1000548123 135
73 3300009093 Ga0105240_10891324 Ga0105240_108913242 135
74 3300009094 Ga0111539_10022198 Ga0111539_100221984 135
75 3300009094 Ga0111539_10035488 Ga0111539_100354883 135
76 3300009094 Ga0111539_11534721 Ga0111539_115347212 135
77 3300009176 Ga0105242_12226135 Ga0105242_122261352 135
78 3300013104 Ga0157370_10237742 Ga0157370_102377422 135
79 3300014326 Ga0157380_10001555 Ga0157380_100015556 135
80 3300014969 Ga0157376_11635812 Ga0157376_116358121 135
81 3300025298 Ga0209050_1008791 Ga0209050_10087912 135
82 3300025304 Ga0209257_1000007 Ga0209257_1000007734 135
83 3300025304 Ga0209257_1138027 Ga0209257_11380272 135
84 3300025913 Ga0207695_10610022 Ga0207695_106100222 135
85 3300025928 Ga0207700_10311923 Ga0207700_103119231 135
86 3300025929 Ga0207664_10051361 Ga0207664_100513611 135
87 3300025931 Ga0207644_10535201 Ga0207644_105352012 135
88 3300025936 Ga0207670_10796813 Ga0207670_107968132 135
89 3300025949 Ga0207667_10290510 Ga0207667_102905102 135
90 3300026089 Ga0207648_10842115 Ga0207648_108421152 135
91 3300026095 Ga0207676_10277374 Ga0207676_102773742 135
92 3300026095 Ga0207676_10400899 Ga0207676_104008992 135
93 3300027907 Ga0207428_10023235 Ga0207428_100232356 135
94 3300027907 Ga0207428_10025541 Ga0207428_100255416 135
95 3300028379 Ga0268266_10849527 Ga0268266_108495272 135
96 3300028794 Ga0307515_10000094 Ga0307515_1000009465 135
97 3300028794 Ga0307515_10150631 Ga0307515_101506314 135
98 3300031456 Ga0307513_10044626 Ga0307513_100446265 135
99 3300031456 Ga0307513_10270472 Ga0307513_102704722 135
100 3300031507 Ga0307509_10207430 Ga0307509_102074302 135
101 3300031507 Ga0307509_10272468 Ga0307509_102724682 135
102 3300031507 Ga0307509_10482053 Ga0307509_104820532 135
103 3300031548 Ga0307408_100106165 Ga0307408_1001061652 135
104 3300031649 Ga0307514_10058279 Ga0307514_100582794 135
105 3300031727 Ga0316576_10090517 Ga0316576_100905172 135
106 3300031727 Ga0316576_10115617 Ga0316576_101156172 135
107 3300031727 Ga0316576_10119894 Ga0316576_101198942 135
108 3300031824 Ga0307413_12092297 Ga0307413_120922971 135
109 3300035398 Ga0316574_0023686 Ga0316574_0023686_1645_2052 135
110 3300035695 Ga0373927_0007295 Ga0373927_0007295_7039_7446 135
111 3300035724 Ga0373933_0121707 Ga0373933_0121707_417_824 135
112 3300036712 Ga0316584_0097264 Ga0316584_0097264_92_499 135
113 3300041458 Ga0451798_0231232 Ga0451798_0231232_270_677 135
114 3300041458 Ga0451798_0813684 Ga0451798_0813684_192_599 135
115 3300041486 Ga0451807_0069373 Ga0451807_0069373_68_475 135
116 3300041494 Ga0451837_1427478 Ga0451837_1427478_333_740 135
117 3300042876 Ga0451577_0065032 Ga0451577_0065032_1628_2038 135
118 3300042876 Ga0451577_0698293 Ga0451577_0698293_409_816 135
119 3300044673 Ga0453683_0019003 Ga0453683_0019003_101_511 135
120 3300044706 Ga0466964_0011353 Ga0466964_0011353_2826_3233 135
121 3300044712 Ga0453684_0004423 Ga0453684_0004423_10048_10455 135
122 3300044712 Ga0453684_0600008 Ga0453684_0600008_634_1044 135
123 3300044712 Ga0453684_0617016 Ga0453684_0617016_330_737 135
124 3300044712 Ga0453684_0728252 Ga0453684_0728252_314_724 135
125 3300044842 Ga0466957_1013730 Ga0466957_1013730_30_455 135
126 3300045051 Ga0451576_0015202 Ga0451576_0015202_4430_4840 135
127 3300046460 Ga0495638_0000004 Ga0495638_0000004_523033_523440 135
128 3300046477 Ga0495664_0827152 Ga0495664_0827152_116_523 135
129 3300049670 Ga0501236_000137 Ga0501236_000137_3651_4058 135
130 3300049674 Ga0501242_030185 Ga0501242_030185_145_552 135
131 3300049675 Ga0501243_045833 Ga0501243_045833_229_636 135
132 3300049686 Ga0501257_001079 Ga0501257_001079_1422_1829 135
133 3300049761 Ga0501264_000291 Ga0501264_000291_6667_7074 135
134 3300050509 nmdc:mga0qj67_66906_c1 nmdc:mga0qj67_66906_c1_1197_1604 135
135 3300050511 nmdc:mga08y16_4813_c1 nmdc:mga08y16_4813_c1_2932_3339 135
136 3300050511 nmdc:mga08y16_95252_c1 nmdc:mga08y16_95252_c1_818_1225 135
137 3300053093 Ga0500651_0217464 Ga0500651_0217464_510_917 135
138 3300053104 Ga0500556_0003187 Ga0500556_0003187_3512_3919 135
139 3300053105 Ga0500557_000631 Ga0500557_000631_3972_4379 135
140 3300053131 Ga0500652_327486 Ga0500652_327486_72_479 135
141 3300053153 Ga0500616_0000015 Ga0500616_0000015_304917_305324 135
142 3300053153 Ga0500616_0019906 Ga0500616_0019906_1589_1999 135
143 3300053153 Ga0500616_0099205 Ga0500616_0099205_595_1002 135
144 3300053156 Ga0500622_0010278 Ga0500622_0010278_4248_4655 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

28

114

0.97

PF13279

4HBT_2

Thioesterase-like superfamily

20

141

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egi-assembly1.cif.gz_G crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9453 4 114
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9386 4 110
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9346 4 130
1z54-assembly1.cif.gz_C crystal structure of a hypothetical protein tt1821 from thermus thermophilus 0.932 4 134
5t06-assembly1.cif.gz_C crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa 0.9294 3 129
ID Description Score Start End Superfamily
2egiG00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9453 4 114 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9386 4 110 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9294 3 129 3.10.129.10
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9263 2 131 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9256 4 129 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1I1F5P4-F1-model_v4 Acyl-CoA thioester hydrolase 0.9869 2 135 GO:0016020
GO:0047617
AF-A0A848T210-F1-model_v4 Acyl-CoA thioesterase 0.9854 1 133 GO:0047617
AF-A0A1P8E2F7-F1-model_v4 deleted 0.983 1 135
AF-A0A2D5JLA2-F1-model_v4 Thioesterase 0.9814 1 135 GO:0047617
AF-A0A2T2VG43-F1-model_v4 Thioesterase 0.9808 1 134 GO:0047617

Feature Viewer

pLDDT pTM Quality
96.23 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map