F191934

General Info

Members Datasets Scaffolds Average Seq Length
144 109 288 122

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10482300|Ga0207691_104823002
Length 147
Sequence MVWRKTGMYDSLTRSKSKVFSVKIKCMQKKKTLVLGASQNPQRYSYLALQRLAAHQQPAVAIGARKGQVGETVIETEKKPFEDIDTVTLYLNPVRQKEYYDYILSLQPKRIIFNPGAENDELAELAEKKGIKVQEACTLVLLSTGQF

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
101 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
102 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
109 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 1.39
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 25.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10482300 3300025940 Bacteria 1054
2 ARcpr5yngRDRAFT_c012115 3300000043 Bacteria 727
3 JGI25406J46586_10190228 3300003203 Bacteria 599
4 rootH2_10143967 3300003320 Bacteria 1101
5 Ga0065714_10405134 3300005288 Bacteria 580
6 Ga0070676_10596940 3300005328 Bacteria 796
7 Ga0070683_100409691 3300005329 Bacteria 1293
8 Ga0070670_100029006 3300005331 Bacteria 4763
9 Ga0070670_100106689 3300005331 Bacteria 2414
10 Ga0070677_10109934 3300005333 Unclassified 1229
11 Ga0068869_100273982 3300005334 Bacteria 1355
12 Ga0070666_10062011 3300005335 Bacteria 2532
13 Ga0070682_100000152 3300005337 Bacteria 54283
14 Ga0070682_101798657 3300005337 Unclassified 534
15 Ga0068868_100027827 3300005338 Bacteria 4315
16 Ga0070689_100120743 3300005340 Bacteria 2093
17 Ga0070689_100563076 3300005340 Bacteria 983
18 Ga0070668_100159706 3300005347 Unclassified 1828
19 Ga0070675_100375076 3300005354 Unclassified 1265
20 Ga0070671_100275511 3300005355 Bacteria 1430
21 Ga0070671_100836551 3300005355 Bacteria 802
22 Ga0070673_100319621 3300005364 Bacteria 1371
23 Ga0070673_101459670 3300005364 Bacteria 644
24 Ga0070688_100021900 3300005365 Bacteria 3738
25 Ga0070700_100240931 3300005441 Bacteria 1292
26 Ga0070662_100046724 3300005457 Bacteria 3111
27 Ga0068867_100346248 3300005459 Bacteria 1239
28 Ga0068867_102226370 3300005459 Bacteria 520
29 Ga0070684_100245036 3300005535 Bacteria 1638
30 Ga0068853_101369946 3300005539 Bacteria 684
31 Ga0070665_100009600 3300005548 Bacteria 9788
32 Ga0068855_100418980 3300005563 Bacteria 1465
33 Ga0068857_100574790 3300005577 Bacteria 1063
34 Ga0068854_101876926 3300005578 Unclassified 550
35 Ga0068856_100985291 3300005614 Bacteria 861
36 Ga0068852_100031520 3300005616 Bacteria 4376
37 Ga0068859_101259942 3300005617 Bacteria 815
38 Ga0068864_100386251 3300005618 Bacteria 1328
39 Ga0068864_101186880 3300005618 Bacteria 761
40 Ga0068861_100209973 3300005719 Unclassified 1639
41 Ga0068851_10277871 3300005834 Unclassified 957
42 Ga0068851_10793311 3300005834 Unclassified 588
43 Ga0068863_100850688 3300005841 Bacteria 911
44 Ga0068860_100534385 3300005843 Bacteria 1173
45 Ga0081539_10000874 3300005985 Bacteria 57737
46 Ga0081539_10170308 3300005985 Bacteria 1030
47 Ga0070716_100337112 3300006173 Bacteria 1062
48 Ga0075366_10063002 3300006195 Unclassified 2204
49 Ga0068871_100018991 3300006358 Bacteria 5239
50 Ga0068871_100285003 3300006358 Bacteria 1446
51 Ga0068865_100089820 3300006881 Unclassified 2226
52 Ga0097620_101259937 3300006931 Bacteria 815
53 Ga0105240_10048516 3300009093 Bacteria 5366
54 Ga0105240_10305639 3300009093 Bacteria 1818
55 Ga0105247_10356567 3300009101 Unclassified 1030
56 Ga0105247_10634982 3300009101 Unclassified 796
57 Ga0105242_10144227 3300009176 Unclassified 2070
58 Ga0105248_10038321 3300009177 Bacteria 5364
59 Ga0105249_10014989 3300009553 Bacteria 6856
60 Ga0105249_10537045 3300009553 Bacteria 1219
61 Ga0105239_10028836 3300010375 Bacteria 6103
62 Ga0105239_10070391 3300010375 Bacteria 3843
63 Ga0105239_10667604 3300010375 Unclassified 1188
64 Ga0105246_12192454 3300011119 Unclassified 537
65 Ga0157370_10396074 3300013104 Bacteria 1271
66 Ga0157374_10194458 3300013296 Bacteria 1985
67 Ga0157378_10007620 3300013297 Bacteria 9449
68 Ga0157378_10060956 3300013297 Unclassified 3366
69 Ga0157378_10651615 3300013297 Bacteria 1069
70 Ga0157378_11696218 3300013297 Unclassified 679
71 Ga0163162_10009301 3300013306 Bacteria 9555
72 Ga0163162_10126051 3300013306 Bacteria 2667
73 Ga0163162_10323449 3300013306 Bacteria 1675
74 Ga0157372_10418497 3300013307 Unclassified 1562
75 Ga0157375_10876919 3300013308 Bacteria 1042
76 Ga0157375_10999778 3300013308 Bacteria 976
77 Ga0157380_10497711 3300014326 Bacteria 1183
78 Ga0157379_10169642 3300014968 Bacteria 1970
79 Ga0157376_10475277 3300014969 Bacteria 1224
80 Ga0157376_10921910 3300014969 Bacteria 893
81 Ga0207697_10106154 3300025315 Unclassified 1200
82 Ga0207656_10499607 3300025321 Bacteria 617
83 Ga0207680_10291597 3300025903 Bacteria 1136
84 Ga0207647_10027874 3300025904 Bacteria 3678
85 Ga0207645_10906795 3300025907 Unclassified 599
86 Ga0207695_10018247 3300025913 Bacteria 8119
87 Ga0207695_10310783 3300025913 Bacteria 1466
88 Ga0207657_11406137 3300025919 Bacteria 524
89 Ga0207650_10036433 3300025925 Bacteria 3580
90 Ga0207650_10066892 3300025925 Bacteria 2695
91 Ga0207644_10714030 3300025931 Bacteria 836
92 Ga0207706_10179901 3300025933 Bacteria 1857
93 Ga0207686_10098021 3300025934 Unclassified 1951
94 Ga0207670_10197117 3300025936 Bacteria 1527
95 Ga0207689_10109832 3300025942 Bacteria 2266
96 Ga0207661_10512877 3300025944 Unclassified 1096
97 Ga0207679_10306597 3300025945 Bacteria 1370
98 Ga0207667_11407780 3300025949 Unclassified 671
99 Ga0207651_11518710 3300025960 Bacteria 603
100 Ga0207712_10263370 3300025961 Bacteria 1399
101 Ga0207668_10175281 3300025972 Unclassified 1686
102 Ga0207668_10262941 3300025972 Bacteria 1407
103 Ga0207668_10766966 3300025972 Unclassified 852
104 Ga0207640_12198192 3300025981 Unclassified 501
105 Ga0207677_10086912 3300026023 Bacteria 2262
106 Ga0207703_10334465 3300026035 Bacteria 1390
107 Ga0207639_10743098 3300026041 Bacteria 912
108 Ga0207708_10817285 3300026075 Bacteria 803
109 Ga0207702_10917777 3300026078 Bacteria 868
110 Ga0207648_10045040 3300026089 Bacteria 3871
111 Ga0207648_10046614 3300026089 Bacteria 3801
112 Ga0207648_10398242 3300026089 Bacteria 1247
113 Ga0207676_10456129 3300026095 Bacteria 1206
114 Ga0207674_12151090 3300026116 Bacteria 521
115 Ga0207675_100085965 3300026118 Bacteria 2953
116 Ga0207698_10283577 3300026142 Bacteria 1533
117 Ga0268266_10002709 3300028379 Bacteria 18586
118 Ga0268264_10102312 3300028381 Unclassified 2493
119 Ga0268264_10215584 3300028381 Bacteria 1765
120 Ga0265334_10129942 3300028573 Bacteria 897
121 Ga0316579_10212829 3300031691 Unclassified 935
122 Ga0316579_10280719 3300031691 Unclassified 805
123 Ga0316576_10231373 3300031727 Unclassified 1390
124 Ga0316576_10569351 3300031727 Unclassified 829
125 Ga0316578_10686707 3300031728 Unclassified 597
126 Ga0307414_10074263 3300032004 Bacteria 2463
127 Ga0316580_10084779 3300032139 Unclassified 969
128 Ga0316580_10150397 3300032139 Unclassified 715
129 Ga0316580_10200504 3300032139 Unclassified 615
130 Ga0316574_0278857 3300035398 Bacteria 1065
131 Ga0316582_0015022 3300036647 Unclassified 4413
132 Ga0316584_0036079 3300036712 Bacteria 3669
133 Ga0316584_0360756 3300036712 Bacteria 1042
134 Ga0400483_052680 3300039062 Bacteria 1891
135 Ga0400483_198943 3300039062 Bacteria 1059
136 Ga0451793_0108201 3300041452 Bacteria 512
137 Ga0451843_0734571 3300041509 Bacteria 574
138 Ga0466972_0000017 3300044658 Bacteria 199884
139 Ga0495633_0319196 3300046558 Bacteria 705
140 Ga0495611_0255494 3300046648 Bacteria 812
141 Ga0495672_0076521 3300047320 Bacteria 1879
142 Ga0496104_1193966 3300048907 Bacteria 664
143 Ga0501269_023576 3300049766 Unclassified 772
144 Ga0500611_000021 3300053727 Bacteria 102395
145 Ga0207691_10482300
146 ARcpr5yngRDRAFT_c012115
147 JGI25406J46586_10190228
148 rootH2_10143967
149 Ga0065714_10405134
150 Ga0070676_10596940
151 Ga0070683_100409691
152 Ga0070670_100029006
153 Ga0070670_100106689
154 Ga0070677_10109934
155 Ga0068869_100273982
156 Ga0070666_10062011
157 Ga0070682_100000152
158 Ga0070682_101798657
159 Ga0068868_100027827
160 Ga0070689_100120743
161 Ga0070689_100563076
162 Ga0070668_100159706
163 Ga0070675_100375076
164 Ga0070671_100275511
165 Ga0070671_100836551
166 Ga0070673_100319621
167 Ga0070673_101459670
168 Ga0070688_100021900
169 Ga0070700_100240931
170 Ga0070662_100046724
171 Ga0068867_100346248
172 Ga0068867_102226370
173 Ga0070684_100245036
174 Ga0068853_101369946
175 Ga0070665_100009600
176 Ga0068855_100418980
177 Ga0068857_100574790
178 Ga0068854_101876926
179 Ga0068856_100985291
180 Ga0068852_100031520
181 Ga0068859_101259942
182 Ga0068864_100386251
183 Ga0068864_101186880
184 Ga0068861_100209973
185 Ga0068851_10277871
186 Ga0068851_10793311
187 Ga0068863_100850688
188 Ga0068860_100534385
189 Ga0081539_10000874
190 Ga0081539_10170308
191 Ga0070716_100337112
192 Ga0075366_10063002
193 Ga0068871_100018991
194 Ga0068871_100285003
195 Ga0068865_100089820
196 Ga0097620_101259937
197 Ga0105240_10048516
198 Ga0105240_10305639
199 Ga0105247_10356567
200 Ga0105247_10634982
201 Ga0105242_10144227
202 Ga0105248_10038321
203 Ga0105249_10014989
204 Ga0105249_10537045
205 Ga0105239_10028836
206 Ga0105239_10070391
207 Ga0105239_10667604
208 Ga0105246_12192454
209 Ga0157370_10396074
210 Ga0157374_10194458
211 Ga0157378_10007620
212 Ga0157378_10060956
213 Ga0157378_10651615
214 Ga0157378_11696218
215 Ga0163162_10009301
216 Ga0163162_10126051
217 Ga0163162_10323449
218 Ga0157372_10418497
219 Ga0157375_10876919
220 Ga0157375_10999778
221 Ga0157380_10497711
222 Ga0157379_10169642
223 Ga0157376_10475277
224 Ga0157376_10921910
225 Ga0207697_10106154
226 Ga0207656_10499607
227 Ga0207680_10291597
228 Ga0207647_10027874
229 Ga0207645_10906795
230 Ga0207695_10018247
231 Ga0207695_10310783
232 Ga0207657_11406137
233 Ga0207650_10036433
234 Ga0207650_10066892
235 Ga0207644_10714030
236 Ga0207706_10179901
237 Ga0207686_10098021
238 Ga0207670_10197117
239 Ga0207689_10109832
240 Ga0207661_10512877
241 Ga0207679_10306597
242 Ga0207667_11407780
243 Ga0207651_11518710
244 Ga0207712_10263370
245 Ga0207668_10175281
246 Ga0207668_10262941
247 Ga0207668_10766966
248 Ga0207640_12198192
249 Ga0207677_10086912
250 Ga0207703_10334465
251 Ga0207639_10743098
252 Ga0207708_10817285
253 Ga0207702_10917777
254 Ga0207648_10045040
255 Ga0207648_10046614
256 Ga0207648_10398242
257 Ga0207676_10456129
258 Ga0207674_12151090
259 Ga0207675_100085965
260 Ga0207698_10283577
261 Ga0268266_10002709
262 Ga0268264_10102312
263 Ga0268264_10215584
264 Ga0265334_10129942
265 Ga0316579_10212829
266 Ga0316579_10280719
267 Ga0316576_10231373
268 Ga0316576_10569351
269 Ga0316578_10686707
270 Ga0307414_10074263
271 Ga0316580_10084779
272 Ga0316580_10150397
273 Ga0316580_10200504
274 Ga0316574_0278857
275 Ga0316582_0015022
276 Ga0316584_0036079
277 Ga0316584_0360756
278 Ga0400483_052680
279 Ga0400483_198943
280 Ga0451793_0108201
281 Ga0451843_0734571
282 Ga0466972_0000017
283 Ga0495633_0319196
284 Ga0495611_0255494
285 Ga0495672_0076521
286 Ga0496104_1193966
287 Ga0501269_023576
288 Ga0500611_000021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

30

143

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ff4-assembly1.cif.gz_A crystal structure of uncharacterized protein chu_1412 0.9827 2 122
3ff4-assembly1.cif.gz_A crystal structure of uncharacterized protein chu_1412 0.9748 2 122
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.8912 3 119
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.8847 3 120
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8618 2 108
ID Description Score Start End Superfamily
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9767 3 122 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9687 3 122 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.852 3 122 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8499 5 115 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8331 3 122 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1J5SU64-F1-model_v4 CoA-binding domain-containing protein 1.003 5 122
AF-A0A4Q0AZ43-F1-model_v4 CoA-binding protein 1.001 5 122
AF-A0A2D7VQK0-F1-model_v4 CoA-binding protein 1.001 5 122
AF-A0A1M3G145-F1-model_v4 CoA-binding protein 1.001 2 122
AF-A0A354D9Z0-F1-model_v4 deleted 1.001 5 122

Map