F191325

General Info

Members Datasets Scaffolds Average Seq Length
144 101 288 222

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10383871|Ga0070717_103838711
Length 237
Sequence MQRVAIEKKVLSENDQIAARLRDALRDHGTLSVNLISSPGSGKTTLLEKTLKMLPAGTRAAVLTGDIQTDNDARRLARYGYPVRQITTAGACHLDARMVENHLAAWLDEGADKPLDLLFIENVGNLVCPTSYDLGEDAKIVVLSVTEGDDKPLKYPGIFRKAELMILNKIDLLPYVPFDPQLALENARRIHPDIEIIETSCTTGAGLELWLGWLAHRAEAKKTALRAEEADHAVIGN

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
55 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
100 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 2.78
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10383871 3300006028 Unclassified 1260
2 rootH2_10112215 3300003320 Bacteria 4718
3 rootH2_10112216 3300003320 Bacteria 3056
4 Ga0070683_100255857 3300005329 Unclassified 1666
5 Ga0070670_100077915 3300005331 Bacteria 2848
6 Ga0070666_10466288 3300005335 Bacteria 913
7 Ga0070680_100467067 3300005336 Bacteria 1078
8 Ga0070661_100756981 3300005344 Bacteria 795
9 Ga0070673_100063344 3300005364 Bacteria 2942
10 Ga0070688_100077982 3300005365 Bacteria 2136
11 Ga0070709_10066221 3300005434 Bacteria 2316
12 Ga0070714_100001427 3300005435 Bacteria 17364
13 Ga0070713_100176645 3300005436 Bacteria 1917
14 Ga0070711_100014414 3300005439 Bacteria 4982
15 Ga0070678_100149904 3300005456 Unclassified 1877
16 Ga0070681_10567009 3300005458 Bacteria 1049
17 Ga0070679_100100274 3300005530 Bacteria 2882
18 Ga0070684_100311236 3300005535 Bacteria 1446
19 Ga0070665_100015023 3300005548 Bacteria 7770
20 Ga0068855_100154648 3300005563 Bacteria 2606
21 Ga0068857_100033555 3300005577 Bacteria 4540
22 Ga0068856_100111107 3300005614 Bacteria 2738
23 Ga0068856_100246983 3300005614 Bacteria 1800
24 Ga0068863_100006034 3300005841 Bacteria 11886
25 Ga0068863_100075357 3300005841 Bacteria 3192
26 Ga0070717_10150467 3300006028 Bacteria 2013
27 Ga0070717_10661113 3300006028 Unclassified 949
28 Ga0070716_100442064 3300006173 Unclassified 946
29 Ga0097621_100759113 3300006237 Bacteria 896
30 Ga0068871_100146407 3300006358 Bacteria 2011
31 Ga0075436_100188481 3300006914 Bacteria 1459
32 Ga0105247_10470328 3300009101 Bacteria 910
33 Ga0105241_10136925 3300009174 Bacteria 1989
34 Ga0105248_10067622 3300009177 Bacteria 4012
35 Ga0105248_10467145 3300009177 Unclassified 1422
36 Ga0105248_10979335 3300009177 Bacteria 955
37 Ga0105237_10240024 3300009545 Bacteria 1813
38 Ga0105237_11129209 3300009545 Bacteria 790
39 Ga0157374_10173306 3300013296 Bacteria 2105
40 Ga0157374_10337740 3300013296 Bacteria 1495
41 Ga0157374_10338684 3300013296 Unclassified 1493
42 Ga0157374_10393868 3300013296 Bacteria 1381
43 Ga0157378_10161670 3300013297 Bacteria 2094
44 Ga0157375_10097850 3300013308 Bacteria 3010
45 Ga0163163_10010440 3300014325 Bacteria 8355
46 Ga0163163_10049329 3300014325 Bacteria 4142
47 Ga0163163_10354510 3300014325 Bacteria 1523
48 Ga0157379_10021891 3300014968 Bacteria 5664
49 Ga0157379_10345656 3300014968 Bacteria 1361
50 Ga0157379_10366258 3300014968 Bacteria 1321
51 Ga0157376_10020415 3300014969 Bacteria 5124
52 Ga0157376_10398429 3300014969 Bacteria 1330
53 Ga0157376_10949238 3300014969 Unclassified 880
54 Ga0213871_10023093 3300021441 Bacteria 1564
55 Ga0207705_10261424 3300025909 Unclassified 1322
56 Ga0207671_10296190 3300025914 Bacteria 1278
57 Ga0207663_10011801 3300025916 Bacteria 4704
58 Ga0207660_10609947 3300025917 Bacteria 889
59 Ga0207652_10174221 3300025921 Bacteria 1931
60 Ga0207687_10546706 3300025927 Bacteria 971
61 Ga0207700_10002708 3300025928 Bacteria 10211
62 Ga0207664_10023198 3300025929 Bacteria 4646
63 Ga0207711_10135624 3300025941 Bacteria 2210
64 Ga0207667_10143147 3300025949 Bacteria 2461
65 Ga0207651_10004715 3300025960 Bacteria 6923
66 Ga0207702_10114909 3300026078 Bacteria 2399
67 Ga0207702_10155114 3300026078 Bacteria 2087
68 Ga0207641_10026653 3300026088 Bacteria 4772
69 Ga0207674_10003664 3300026116 Bacteria 18742
70 Ga0207698_10145219 3300026142 Bacteria 2051
71 Ga0268266_10014390 3300028379 Bacteria 6803
72 Ga0265323_10005249 3300028653 Bacteria 5507
73 Ga0265336_10051185 3300028666 Bacteria 1247
74 Ga0265338_10029095 3300028800 Bacteria 5489
75 Ga0265338_10133673 3300028800 Bacteria 1954
76 Ga0265338_10201557 3300028800 Bacteria 1500
77 Ga0265324_10031787 3300029957 Bacteria 1847
78 Ga0265330_10076276 3300031235 Bacteria 1447
79 Ga0265320_10002331 3300031240 Bacteria 13318
80 Ga0265329_10033766 3300031242 Bacteria 1654
81 Ga0265329_10060415 3300031242 Bacteria 1200
82 Ga0265339_10098917 3300031249 Unclassified 1521
83 Ga0265331_10084068 3300031250 Bacteria 1475
84 Ga0265316_10008758 3300031344 Bacteria 9354
85 Ga0265316_10028501 3300031344 Bacteria 4606
86 Ga0265316_10049068 3300031344 Bacteria 3327
87 Ga0265316_10058575 3300031344 Bacteria 2999
88 Ga0265316_10058758 3300031344 Bacteria 2993
89 Ga0265316_10060509 3300031344 Bacteria 2943
90 Ga0265316_10096808 3300031344 Bacteria 2247
91 Ga0265316_10246962 3300031344 Bacteria 1311
92 Ga0265316_10307717 3300031344 Bacteria 1153
93 Ga0265316_10438936 3300031344 Bacteria 937
94 Ga0265313_10009295 3300031595 Bacteria 6395
95 Ga0265314_10002545 3300031711 Bacteria 18539
96 Ga0265314_10004172 3300031711 Bacteria 13582
97 Ga0265314_10035523 3300031711 Bacteria 3631
98 Ga0265342_10108337 3300031712 Bacteria 1575
99 Ga0373926_0028322 3300035083 Bacteria 1966
100 Ga0373926_0041269 3300035083 Bacteria 1648
101 Ga0373923_0038553 3300035111 Bacteria 1959
102 Ga0373953_0091852 3300035117 Bacteria 1270
103 Ga0373954_0012122 3300035118 Bacteria 3831
104 Ga0373946_0261504 3300035171 Bacteria 847
105 Ga0373935_0040672 3300035692 Bacteria 2918
106 Ga0373927_0001395 3300035695 Bacteria 18205
107 Ga0373927_0022058 3300035695 Bacteria 4172
108 Ga0373927_0264685 3300035695 Bacteria 1131
109 Ga0373933_0079936 3300035724 Bacteria 2003
110 Ga0373933_0434798 3300035724 Bacteria 858
111 Ga0373947_0098094 3300035725 Bacteria 1838
112 Ga0373937_0003494 3300036401 Bacteria 13218
113 Ga0373937_0013201 3300036401 Bacteria 7274
114 Ga0373925_0045956 3300037068 Bacteria 3245
115 Ga0373925_0184080 3300037068 Bacteria 1655
116 Ga0436360_0141745 3300039438 Bacteria 3393
117 Ga0451577_0528569 3300042876 Bacteria 1071
118 Ga0453684_0000184 3300044712 Bacteria 274619
119 Ga0466959_0040768 3300045049 Bacteria 3430
120 Ga0495651_0425993 3300046462 Bacteria 862
121 Ga0495580_0020695 3300046472 Bacteria 4865
122 Ga0495580_0021885 3300046472 Bacteria 4714
123 Ga0495580_0077846 3300046472 Bacteria 2313
124 Ga0495580_0384207 3300046472 Bacteria 948
125 Ga0495580_0621707 3300046472 Bacteria 712
126 Ga0495582_0275749 3300046473 Bacteria 965
127 Ga0495628_0173328 3300046516 Bacteria 1635
128 Ga0495665_0183777 3300046531 Bacteria 1086
129 Ga0495587_0030166 3300046536 Unclassified 3289
130 Ga0495658_0291695 3300046683 Bacteria 1031
131 Ga0495669_0070094 3300046684 Bacteria 1596
132 Ga0495581_0010448 3300047315 Bacteria 5368
133 Ga0495581_0108613 3300047315 Bacteria 1613
134 Ga0495604_0240756 3300047317 Bacteria 1237
135 Ga0495675_0278634 3300047444 Bacteria 998
136 Ga0495684_0104479 3300047471 Bacteria 2140
137 Ga0495686_0002666 3300047472 Bacteria 16434
138 Ga0496104_0732266 3300048907 Bacteria 896
139 Ga0496109_0086378 3300048912 Bacteria 2897
140 Ga0496112_0001993 3300048915 Bacteria 16155
141 Ga0496115_0262606 3300048918 Bacteria 1420
142 Ga0501045_0612146 3300049824 Bacteria 806
143 Ga0495619_0133735 3300053085 Bacteria 1705
144 Ga0500616_0001324 3300053153 Bacteria 24390
145 Ga0070717_10383871
146 rootH2_10112215
147 rootH2_10112216
148 Ga0070683_100255857
149 Ga0070670_100077915
150 Ga0070666_10466288
151 Ga0070680_100467067
152 Ga0070661_100756981
153 Ga0070673_100063344
154 Ga0070688_100077982
155 Ga0070709_10066221
156 Ga0070714_100001427
157 Ga0070713_100176645
158 Ga0070711_100014414
159 Ga0070678_100149904
160 Ga0070681_10567009
161 Ga0070679_100100274
162 Ga0070684_100311236
163 Ga0070665_100015023
164 Ga0068855_100154648
165 Ga0068857_100033555
166 Ga0068856_100111107
167 Ga0068856_100246983
168 Ga0068863_100006034
169 Ga0068863_100075357
170 Ga0070717_10150467
171 Ga0070717_10661113
172 Ga0070716_100442064
173 Ga0097621_100759113
174 Ga0068871_100146407
175 Ga0075436_100188481
176 Ga0105247_10470328
177 Ga0105241_10136925
178 Ga0105248_10067622
179 Ga0105248_10467145
180 Ga0105248_10979335
181 Ga0105237_10240024
182 Ga0105237_11129209
183 Ga0157374_10173306
184 Ga0157374_10337740
185 Ga0157374_10338684
186 Ga0157374_10393868
187 Ga0157378_10161670
188 Ga0157375_10097850
189 Ga0163163_10010440
190 Ga0163163_10049329
191 Ga0163163_10354510
192 Ga0157379_10021891
193 Ga0157379_10345656
194 Ga0157379_10366258
195 Ga0157376_10020415
196 Ga0157376_10398429
197 Ga0157376_10949238
198 Ga0213871_10023093
199 Ga0207705_10261424
200 Ga0207671_10296190
201 Ga0207663_10011801
202 Ga0207660_10609947
203 Ga0207652_10174221
204 Ga0207687_10546706
205 Ga0207700_10002708
206 Ga0207664_10023198
207 Ga0207711_10135624
208 Ga0207667_10143147
209 Ga0207651_10004715
210 Ga0207702_10114909
211 Ga0207702_10155114
212 Ga0207641_10026653
213 Ga0207674_10003664
214 Ga0207698_10145219
215 Ga0268266_10014390
216 Ga0265323_10005249
217 Ga0265336_10051185
218 Ga0265338_10029095
219 Ga0265338_10133673
220 Ga0265338_10201557
221 Ga0265324_10031787
222 Ga0265330_10076276
223 Ga0265320_10002331
224 Ga0265329_10033766
225 Ga0265329_10060415
226 Ga0265339_10098917
227 Ga0265331_10084068
228 Ga0265316_10008758
229 Ga0265316_10028501
230 Ga0265316_10049068
231 Ga0265316_10058575
232 Ga0265316_10058758
233 Ga0265316_10060509
234 Ga0265316_10096808
235 Ga0265316_10246962
236 Ga0265316_10307717
237 Ga0265316_10438936
238 Ga0265313_10009295
239 Ga0265314_10002545
240 Ga0265314_10004172
241 Ga0265314_10035523
242 Ga0265342_10108337
243 Ga0373926_0028322
244 Ga0373926_0041269
245 Ga0373923_0038553
246 Ga0373953_0091852
247 Ga0373954_0012122
248 Ga0373946_0261504
249 Ga0373935_0040672
250 Ga0373927_0001395
251 Ga0373927_0022058
252 Ga0373927_0264685
253 Ga0373933_0079936
254 Ga0373933_0434798
255 Ga0373947_0098094
256 Ga0373937_0003494
257 Ga0373937_0013201
258 Ga0373925_0045956
259 Ga0373925_0184080
260 Ga0436360_0141745
261 Ga0451577_0528569
262 Ga0453684_0000184
263 Ga0466959_0040768
264 Ga0495651_0425993
265 Ga0495580_0020695
266 Ga0495580_0021885
267 Ga0495580_0077846
268 Ga0495580_0384207
269 Ga0495580_0621707
270 Ga0495582_0275749
271 Ga0495628_0173328
272 Ga0495665_0183777
273 Ga0495587_0030166
274 Ga0495658_0291695
275 Ga0495669_0070094
276 Ga0495581_0010448
277 Ga0495581_0108613
278 Ga0495604_0240756
279 Ga0495675_0278634
280 Ga0495684_0104479
281 Ga0495686_0002666
282 Ga0496104_0732266
283 Ga0496109_0086378
284 Ga0496112_0001993
285 Ga0496115_0262606
286 Ga0501045_0612146
287 Ga0495619_0133735
288 Ga0500616_0001324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

32

198

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hf9-assembly1.cif.gz_A crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form 0.9489 5 215
2wsm-assembly1.cif.gz_A crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.9304 6 214
2wsm-assembly1.cif.gz_B crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.9256 5 211
2hf9-assembly1.cif.gz_A crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form 0.9229 5 215
2wsm-assembly1.cif.gz_A crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.9216 6 214
ID Description Score Start End Superfamily
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9652 2 214 3.40.50.300
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9304 6 214 3.40.50.300
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9216 6 214 3.40.50.300
4lpsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9047 8 221 3.40.50.300
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9015 2 214 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1W9M5P7-F1-model_v4 Hydrogenase accessory protein HypB 0.9779 114 220 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604
AF-A0A7C5RSM0-F1-model_v4 Hydrogenase accessory protein HypB 0.9754 2 217 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604
AF-A0A824ZTD2-F1-model_v4 deleted 0.9738 3 215
AF-A0A1F2QBG3-F1-model_v4 Hydrogenase accessory protein HypB 0.9735 2 224 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604
AF-A0A1G0M5J7-F1-model_v4 Hydrogenase accessory protein HypB 0.9726 2 217 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604

Map