F189391

General Info

Members Datasets Scaffolds Average Seq Length
143 116 103 170

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0003946|Ga0395900_0003946_3578_4162
Length 194
Sequence MAAEMRRIKNETEKQRWDRNFSDLLQELRVAQTGVQILFAFLLTLPFSSGFPKTTEFQRNTYIVALMAAAFATTMIIAPVAFHRALFRQGRKPELVRYAHRMATGGLAFMLIAIVASVLLITDYLLNPWASTILTVIAGGWFLTFWAVVPWFRHHWIDEDLEEENEESATGRVHPGSPDGVVNAGDRSVSTRDP

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
3 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
4 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
5 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
6 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
7 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
8 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
9 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
10 2855683550 Micromonospora sp. RP3T Isolate Unclassified
11 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
12 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
13 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
14 2858868258 Micromonospora sp. MH33 Isolate Unclassified
15 2858882152 Micromonospora noduli MED15 Isolate Nodule
16 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
17 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
18 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
19 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
20 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
21 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
22 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
23 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
24 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
25 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
26 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
27 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
28 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
29 2902582711 Micromonospora sp. AP08 Isolate Unclassified
30 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
31 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
32 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
86 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
87 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
88 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
89 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
90 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
104 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
105 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
106 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
107 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
108 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
109 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
110 649633069 Micromonospora sp. L5 Isolate Unclassified
111 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
112 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
113 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
114 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
115 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
116 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.03
Metatranscriptomes 0
Isolates 27.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 3.5
Rhizoplane 1.4
Rhizosphere 57.34
Stem 0
Stem Tuber 0
Unclassified 32.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10020801 3300003203 Bacteria 2645
2 JGI25406J46586_10022741 3300003203 Bacteria 2491
3 Ga0070683_101359474 3300005329 Bacteria 683
4 Ga0070668_100001221 3300005347 Bacteria 18265
5 Ga0070688_100191186 3300005365 Bacteria 1426
6 Ga0070663_100348231 3300005455 Bacteria 1199
7 Ga0070685_10089153 3300005466 Bacteria 1864
8 Ga0070685_10111615 3300005466 Bacteria 1685
9 Ga0070686_100854970 3300005544 Bacteria 737
10 Ga0070665_100375469 3300005548 Bacteria 1429
11 Ga0068859_100056974 3300005617 Bacteria 3936
12 Ga0068859_101017831 3300005617 Bacteria 910
13 Ga0068861_100229320 3300005719 Bacteria 1574
14 Ga0068858_100015023 3300005842 Bacteria 7284
15 Ga0068860_100053883 3300005843 Bacteria 3823
16 Ga0068862_100030344 3300005844 Bacteria 4556
17 Ga0081539_10002110 3300005985 Bacteria 29463
18 Ga0081539_10002173 3300005985 Bacteria 28814
19 Ga0081539_10007125 3300005985 Bacteria 10325
20 Ga0081539_10032140 3300005985 Bacteria 3220
21 Ga0081539_10040674 3300005985 Bacteria 2727
22 Ga0097620_100056974 3300006931 Bacteria 3936
23 Ga0097620_101017847 3300006931 Bacteria 910
24 Ga0105245_10617645 3300009098 Bacteria 1112
25 Ga0105238_10665409 3300009551 Bacteria 1052
26 Ga0105239_11665067 3300010375 Bacteria 738
27 Ga0157369_10445764 3300013105 Bacteria 1341
28 Ga0163162_10495542 3300013306 Bacteria 1352
29 Ga0157375_10318936 3300013308 Bacteria 1719
30 Ga0163163_10824883 3300014325 Bacteria 991
31 Ga0163163_11900334 3300014325 Bacteria 655
32 Ga0207643_10567241 3300025908 Bacteria 729
33 Ga0207681_10126514 3300025923 Bacteria 1883
34 Ga0207661_10238200 3300025944 Bacteria 1614
35 Ga0207679_10522727 3300025945 Bacteria 1061
36 Ga0207668_10000735 3300025972 Bacteria 20068
37 Ga0207703_10080927 3300026035 Bacteria 2706
38 Ga0207678_10191361 3300026067 Bacteria 1748
39 Ga0207675_100113421 3300026118 Bacteria 2559
40 Ga0268266_10222703 3300028379 Bacteria 1735
41 Ga0268265_10012931 3300028380 Bacteria 5666
42 Ga0268264_10021609 3300028381 Bacteria 5254
43 Ga0307517_10114980 3300028786 Bacteria 2022
44 Ga0307517_10196726 3300028786 Bacteria 1268
45 Ga0307515_10000148 3300028794 Bacteria 170303
46 Ga0307515_10067568 3300028794 Bacteria 4927
47 Ga0307515_10079304 3300028794 Bacteria 4303
48 Ga0307512_10055949 3300030522 Bacteria 3103
49 Ga0307513_10011029 3300031456 Bacteria 11271
50 Ga0307513_10087319 3300031456 Bacteria 3193
51 Ga0307513_10157149 3300031456 Bacteria 2172
52 Ga0307513_10461383 3300031456 Bacteria 993
53 Ga0307509_10016570 3300031507 Bacteria 8523
54 Ga0307508_10009104 3300031616 Bacteria 9144
55 Ga0307508_10082598 3300031616 Bacteria 2795
56 Ga0307514_10049824 3300031649 Bacteria 3255
57 Ga0307516_10000602 3300031730 Bacteria 48705
58 Ga0307516_10014751 3300031730 Bacteria 8255
59 Ga0307516_10041743 3300031730 Bacteria 4556
60 Ga0307405_10041550 3300031731 Bacteria 2793
61 Ga0307413_10400118 3300031824 Bacteria 1076
62 Ga0307410_10098679 3300031852 Bacteria 2090
63 Ga0307410_10153771 3300031852 Bacteria 1716
64 Ga0307410_10321735 3300031852 Bacteria 1227
65 Ga0307406_10002978 3300031901 Bacteria 9235
66 Ga0307406_10076410 3300031901 Bacteria 2212
67 Ga0307407_10032274 3300031903 Bacteria 2845
68 Ga0307407_10294125 3300031903 Bacteria 1130
69 Ga0307412_10034871 3300031911 Bacteria 3210
70 Ga0307409_100005995 3300031995 Bacteria 7084
71 Ga0307409_100011213 3300031995 Bacteria 5634
72 Ga0307409_100108671 3300031995 Bacteria 2320
73 Ga0307409_100274871 3300031995 Bacteria 1554
74 Ga0307416_100110193 3300032002 Bacteria 2423
75 Ga0307415_100007996 3300032126 Bacteria 5831
76 Ga0307507_10180953 3300033179 Bacteria 1507
77 Ga0307510_10391655 3300033180 Bacteria 833
78 Ga0373948_0019284 3300034817 Bacteria 1289
79 Ga0373950_0001621 3300034818 Bacteria 2970
80 Ga0373940_0007677 3300035088 Bacteria 2442
81 Ga0373951_0000042 3300035091 Bacteria 50165
82 Ga0373942_0000630 3300035207 Bacteria 9885
83 Ga0373962_0077590 3300035242 Bacteria 1003
84 Ga0373935_0015018 3300035692 Bacteria 4676
85 Ga0373935_0287728 3300035692 Bacteria 1158
86 Ga0395900_0003946 3300037418 Bacteria 15832
87 Ga0395898_0076144 3300037466 Bacteria 3240
88 Ga0395905_0106019 3300037471 Bacteria 2639
89 Ga0395901_0023836 3300038443 Bacteria 6276
90 Ga0451791_1074807 3300041451 Bacteria 1021
91 Ga0466960_0365457 3300044901 Bacteria 826
92 Ga0466967_0038561 3300045976 Bacteria 4099
93 Ga0495638_0198856 3300046460 Bacteria 1133
94 Ga0496108_0000017 3300048911 Bacteria 235428
95 Ga0501068_0354658 3300049584 Bacteria 943
96 Ga0501070_0430590 3300049586 Bacteria 1065
97 Ga0500644_0058534 3300053088 Bacteria 1348
98 Ga0500651_0068783 3300053093 Bacteria 2205
99 Ga0500641_0094493 3300053096 Bacteria 1278
100 Ga0500650_0198633 3300053098 Bacteria 914
101 Ga0500621_116120 3300053126 Bacteria 1041
102 Ga0500579_204034 3300053143 Bacteria 724
103 Ga0500633_0224696 3300053160 Bacteria 700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025923 Ga0207681_10126514 Ga0207681_101265142 149
2 3300025945 Ga0207679_10522727 Ga0207679_105227272 150
3 3300026067 Ga0207678_10191361 Ga0207678_101913612 150
4 3300028794 Ga0307515_10000148 Ga0307515_10000148100 150
5 3300005544 Ga0070686_100854970 Ga0070686_1008549701 152
6 3300049584 Ga0501068_0354658 Ga0501068_0354658_100_603 156
7 3300049586 Ga0501070_0430590 Ga0501070_0430590_95_739 156
8 3300014325 Ga0163163_11900334 Ga0163163_119003342 158
9 iso_pu_bacteria 2501939600 2501942325 159
10 iso_pu_bacteria 2831935698 2831938531 159
11 iso_pu_bacteria 2832004796 2832005429 159
12 iso_pu_bacteria 2856858025 2856858118 159
13 iso_pu_bacteria 2866065130 2866068722 159
14 iso_pu_bacteria 2867507094 2867512912 159
15 iso_pu_bacteria 2929219909 2929225043 159
16 iso_pu_bacteria 649633069 649813640 159
17 3300013105 Ga0157369_10445764 Ga0157369_104457642 160
18 3300025908 Ga0207643_10567241 Ga0207643_105672411 160
19 3300031730 Ga0307516_10014751 Ga0307516_100147518 160
20 3300031824 Ga0307413_10400118 Ga0307413_104001182 160
21 3300041451 Ga0451791_1074807 Ga0451791_1074807_374_910 160
22 iso_pu_bacteria 2622736626 2623591162 160
23 iso_pu_bacteria 2772190715 2772647235 160
24 iso_pu_bacteria 2855670206 2855672369 160
25 iso_pu_bacteria 2855676851 2855681553 160
26 iso_pu_bacteria 2855683550 2855688861 160
27 iso_pu_bacteria 2857288857 2857290494 160
28 iso_pu_bacteria 2858848962 2858852784 160
29 iso_pu_bacteria 2858868258 2858871544 160
30 iso_pu_bacteria 2858882152 2858886241 160
31 iso_pu_bacteria 2858888857 2858894320 160
32 iso_pu_bacteria 2858895516 2858898645 160
33 iso_pu_bacteria 2858902515 2858908268 160
34 iso_pu_bacteria 2867302475 2867307639 160
35 iso_pu_bacteria 2867312974 2867316433 160
36 iso_pu_bacteria 2867319477 2867324931 160
37 iso_pu_bacteria 2869048445 2869054658 160
38 iso_pu_bacteria 2869061728 2869063844 160
39 iso_pu_bacteria 2869068681 2869075327 160
40 iso_pu_bacteria 2880489317 2880495960 160
41 iso_pu_bacteria 2880495981 2880496408 160
42 iso_pu_bacteria 2902582711 2902584876 160
43 iso_pu_bacteria 2929226422 2929231993 160
44 iso_pu_bacteria 2996221748 2996224834 160
45 iso_pu_bacteria 8003830390 8003835957 160
46 iso_pu_bacteria 8003856774 8003858195 160
47 iso_pu_bacteria 8003870546 8003875926 160
48 iso_pu_bacteria 8054704163 8054705276 160
49 iso_pu_bacteria 8054727385 8054729979 160
50 iso_pu_bacteria 8055412473 8055417584 160
51 3300005455 Ga0070663_100348231 Ga0070663_1003482312 161
52 3300031730 Ga0307516_10000602 Ga0307516_1000060213 161
53 3300005329 Ga0070683_101359474 Ga0070683_1013594741 162
54 3300005365 Ga0070688_100191186 Ga0070688_1001911862 162
55 3300005466 Ga0070685_10089153 Ga0070685_100891532 162
56 3300005617 Ga0068859_101017831 Ga0068859_1010178312 162
57 3300005842 Ga0068858_100015023 Ga0068858_1000150232 162
58 3300005843 Ga0068860_100053883 Ga0068860_1000538836 162
59 3300005844 Ga0068862_100030344 Ga0068862_1000303442 162
60 3300006931 Ga0097620_101017847 Ga0097620_1010178472 162
61 3300009098 Ga0105245_10617645 Ga0105245_106176452 162
62 3300009551 Ga0105238_10665409 Ga0105238_106654091 162
63 3300010375 Ga0105239_11665067 Ga0105239_116650671 162
64 3300013306 Ga0163162_10495542 Ga0163162_104955422 162
65 3300013308 Ga0157375_10318936 Ga0157375_103189363 162
66 3300014325 Ga0163163_10824883 Ga0163163_108248832 162
67 3300025944 Ga0207661_10238200 Ga0207661_102382002 162
68 3300026035 Ga0207703_10080927 Ga0207703_100809275 162
69 3300028381 Ga0268264_10021609 Ga0268264_100216097 162
70 3300028794 Ga0307515_10079304 Ga0307515_100793045 162
71 3300031903 Ga0307407_10294125 Ga0307407_102941252 162
72 3300031995 Ga0307409_100274871 Ga0307409_1002748712 162
73 3300033179 Ga0307507_10180953 Ga0307507_101809532 162
74 3300005347 Ga0070668_100001221 Ga0070668_10000122119 163
75 3300005617 Ga0068859_100056974 Ga0068859_1000569746 163
76 3300006931 Ga0097620_100056974 Ga0097620_1000569746 163
77 3300025972 Ga0207668_10000735 Ga0207668_1000073519 163
78 3300028380 Ga0268265_10012931 Ga0268265_100129313 163
79 3300044901 Ga0466960_0365457 Ga0466960_0365457_138_668 164
80 iso_pu_bacteria 2675903059 2676482385 164
81 3300034817 Ga0373948_0019284 Ga0373948_0019284_709_1227 165
82 3300034818 Ga0373950_0001621 Ga0373950_0001621_889_1407 165
83 3300035088 Ga0373940_0007677 Ga0373940_0007677_1579_2097 165
84 3300035207 Ga0373942_0000630 Ga0373942_0000630_4306_4824 165
85 3300035242 Ga0373962_0077590 Ga0373962_0077590_131_661 165
86 3300005466 Ga0070685_10111615 Ga0070685_101116152 166
87 3300005719 Ga0068861_100229320 Ga0068861_1002293202 166
88 3300026118 Ga0207675_100113421 Ga0207675_1001134213 166
89 iso_pu_bacteria 2751185782 2753266046 166
90 3300031456 Ga0307513_10157149 Ga0307513_101571493 167
91 3300031616 Ga0307508_10082598 Ga0307508_100825982 167
92 3300035091 Ga0373951_0000042 Ga0373951_0000042_37251_37778 167
93 3300053143 Ga0500579_204034 Ga0500579_204034_142_699 168
94 3300031852 Ga0307410_10098679 Ga0307410_100986792 169
95 3300031901 Ga0307406_10076410 Ga0307406_100764102 169
96 3300031995 Ga0307409_100108671 Ga0307409_1001086712 169
97 3300005985 Ga0081539_10032140 Ga0081539_100321404 170
98 3300005985 Ga0081539_10040674 Ga0081539_100406743 170
99 iso_pu_bacteria 2751185782 2753267297 170
100 3300028786 Ga0307517_10114980 Ga0307517_101149803 172
101 3300028794 Ga0307515_10067568 Ga0307515_100675684 172
102 3300030522 Ga0307512_10055949 Ga0307512_100559492 172
103 3300031616 Ga0307508_10009104 Ga0307508_100091046 172
104 3300031731 Ga0307405_10041550 Ga0307405_100415502 172
105 3300031995 Ga0307409_100011213 Ga0307409_1000112135 172
106 3300046460 Ga0495638_0198856 Ga0495638_0198856_300_836 172
107 3300053088 Ga0500644_0058534 Ga0500644_0058534_189_725 172
108 3300053093 Ga0500651_0068783 Ga0500651_0068783_369_905 172
109 3300053096 Ga0500641_0094493 Ga0500641_0094493_13_549 172
110 3300053098 Ga0500650_0198633 Ga0500650_0198633_119_655 172
111 3300053126 Ga0500621_116120 Ga0500621_116120_237_773 172
112 3300053160 Ga0500633_0224696 Ga0500633_0224696_77_613 172
113 3300003203 JGI25406J46586_10022741 JGI25406J46586_100227411 173
114 3300005548 Ga0070665_100375469 Ga0070665_1003754694 173
115 3300005985 Ga0081539_10002173 Ga0081539_1000217322 173
116 3300028379 Ga0268266_10222703 Ga0268266_102227033 173
117 3300028786 Ga0307517_10196726 Ga0307517_101967262 173
118 3300031456 Ga0307513_10011029 Ga0307513_1001102911 173
119 3300031456 Ga0307513_10087319 Ga0307513_100873194 173
120 3300031456 Ga0307513_10461383 Ga0307513_104613832 173
121 3300031507 Ga0307509_10016570 Ga0307509_100165705 173
122 3300031730 Ga0307516_10041743 Ga0307516_100417434 173
123 3300031852 Ga0307410_10153771 Ga0307410_101537712 173
124 3300033180 Ga0307510_10391655 Ga0307510_103916551 173
125 3300035692 Ga0373935_0015018 Ga0373935_0015018_4096_4626 173
126 3300035692 Ga0373935_0287728 Ga0373935_0287728_561_1091 173
127 3300037418 Ga0395900_0003946 Ga0395900_0003946_3578_4162 173
128 3300037466 Ga0395898_0076144 Ga0395898_0076144_546_1130 173
129 3300037471 Ga0395905_0106019 Ga0395905_0106019_1441_2025 173
130 3300038443 Ga0395901_0023836 Ga0395901_0023836_2573_3157 173
131 3300045976 Ga0466967_0038561 Ga0466967_0038561_716_1285 173
132 3300048911 Ga0496108_0000017 Ga0496108_0000017_90204_90758 173
133 3300003203 JGI25406J46586_10020801 JGI25406J46586_100208015 174
134 3300005985 Ga0081539_10002110 Ga0081539_100021104 174
135 3300005985 Ga0081539_10007125 Ga0081539_1000712510 174
136 3300031649 Ga0307514_10049824 Ga0307514_100498243 174
137 3300031852 Ga0307410_10321735 Ga0307410_103217352 174
138 3300031901 Ga0307406_10002978 Ga0307406_100029782 174
139 3300031903 Ga0307407_10032274 Ga0307407_100322745 174
140 3300031911 Ga0307412_10034871 Ga0307412_100348714 174
141 3300031995 Ga0307409_100005995 Ga0307409_1000059954 174
142 3300032002 Ga0307416_100110193 Ga0307416_1001101935 174
143 3300032126 Ga0307415_100007996 Ga0307415_1000079964 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19853

DUF6328

Family of unknown function (DUF6328)

10

150

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dt0-assembly1.cif.gz_A scaffolding protein functional sites using deep learning 0.7839 26 113
2l7a-assembly1.cif.gz_A solution structure of the r3 domain of talin 0.7213 22 113
1l7c-assembly4.cif.gz_C alpha-catenin fragment, residues 385-651 0.6894 26 116
1l7c-assembly4.cif.gz_B alpha-catenin fragment, residues 385-651 0.687 20 116
8dt0-assembly2.cif.gz_B scaffolding protein functional sites using deep learning 0.6847 26 116
ID Description Score Start End Superfamily
af_Q8LQA1_36_188_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.8411 28 109 1.20.140.40
af_Q5ZCD5_2_186_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.8396 58 116 1.20.1410.10
af_O49006_55_217_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.8331 28 116 1.20.140.40
af_I1MVB1_20_179_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.8153 23 109 1.20.140.40
af_I1JKR2_37_204_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.8142 28 109 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A370IAQ5-F1-model_v4 Sodium:proton antiporter 0.9567 11 155 GO:0016020
AF-A0A4Q7V0B6-F1-model_v4 Sodium:proton antiporter 0.9517 8 153 GO:0016020
AF-A0A850CWT2-F1-model_v4 deleted 0.9497 20 155
AF-A0A0A0J182-F1-model_v4 deleted 0.9448 10 159
AF-A0A7V9BYW1-F1-model_v4 Sodium:proton antiporter 0.9425 26 157 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.15 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map