F189265
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 143 | 118 | 286 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100616850|Ga0307416_1006168502 |
| Length | 190 |
| Sequence | VTSEPSPAGKPAVVVAVSRDPEHRMSKVNEPRIRLLEGLGVEGDAHLGRTVQHRSRVARDPTEPNLRQVHLIHEELHDELRGRGFAVVAPGVMGENVTTRGVDLLGLPTGTRLTLGGAAVVEITGLRNPCVQLDGLQPGLMSAVLDRDEDGKLIRRSGVMGIVLTGGDVSPGDPIAVELPPPPHRPLEKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 2 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 11 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 12 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 14 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 15 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 16 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 17 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 18 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 19 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 28 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 38 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 40 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 41 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 42 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 43 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 44 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 45 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 46 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 47 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 48 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 49 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 50 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 51 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 52 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 53 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 54 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 55 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 56 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 57 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 58 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 59 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 60 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 61 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 62 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 63 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 81 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 82 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 83 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 84 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 85 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 86 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 87 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 88 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 89 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 90 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 91 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 92 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 93 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 94 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 95 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 96 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 97 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 98 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 99 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 100 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 101 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 102 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 103 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 104 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 105 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 106 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 107 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 108 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 109 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 110 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 111 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 112 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 113 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 114 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 115 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 116 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 117 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 118 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.51 |
| Metatranscriptomes | 1.4 |
| Isolates | 9.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.2 |
| Nodule | 6.29 |
| Rhizoplane | 2.1 |
| Rhizosphere | 79.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307416_100616850 | 3300032002 | Bacteria | 1166 |
| 2 | Ga0058859_11368413 | 3300004798 | Bacteria | 1258 |
| 3 | Ga0058860_12103785 | 3300004801 | Bacteria | 1416 |
| 4 | Ga0070683_100116310 | 3300005329 | Bacteria | 2524 |
| 5 | Ga0070680_100060185 | 3300005336 | Bacteria | 3108 |
| 6 | Ga0070706_100019686 | 3300005467 | Bacteria | 6224 |
| 7 | Ga0070707_100026603 | 3300005468 | Bacteria | 5495 |
| 8 | Ga0070698_100190265 | 3300005471 | Bacteria | 1990 |
| 9 | Ga0070684_100257339 | 3300005535 | Bacteria | 1596 |
| 10 | Ga0068853_100754665 | 3300005539 | Bacteria | 930 |
| 11 | Ga0068855_101022251 | 3300005563 | Bacteria | 867 |
| 12 | Ga0081539_10000449 | 3300005985 | Bacteria | 87716 |
| 13 | Ga0075368_10274671 | 3300006042 | Bacteria | 723 |
| 14 | Ga0075428_100058695 | 3300006844 | Bacteria | 4212 |
| 15 | Ga0075428_100350518 | 3300006844 | Bacteria | 1584 |
| 16 | Ga0075428_101710413 | 3300006844 | Bacteria | 656 |
| 17 | Ga0075430_100574513 | 3300006846 | Unclassified | 930 |
| 18 | Ga0075431_100020955 | 3300006847 | Bacteria | 6680 |
| 19 | Ga0075434_101263461 | 3300006871 | Bacteria | 750 |
| 20 | Ga0075429_100063767 | 3300006880 | Bacteria | 3210 |
| 21 | Ga0075429_100907170 | 3300006880 | Bacteria | 771 |
| 22 | Ga0111539_10114702 | 3300009094 | Bacteria | 3160 |
| 23 | Ga0111539_10446403 | 3300009094 | Bacteria | 1506 |
| 24 | Ga0105245_10653902 | 3300009098 | Bacteria | 1081 |
| 25 | Ga0114129_10207347 | 3300009147 | Bacteria | 2651 |
| 26 | Ga0114129_10568769 | 3300009147 | Bacteria | 1472 |
| 27 | Ga0105237_10761435 | 3300009545 | Unclassified | 975 |
| 28 | Ga0105239_10086549 | 3300010375 | Bacteria | 3454 |
| 29 | Ga0157370_11077065 | 3300013104 | Bacteria | 726 |
| 30 | Ga0157380_10292762 | 3300014326 | Unclassified | 1496 |
| 31 | Ga0157379_10648164 | 3300014968 | Bacteria | 989 |
| 32 | Ga0213875_10000498 | 3300021388 | Bacteria | 32954 |
| 33 | Ga0207684_10014987 | 3300025910 | Bacteria | 6673 |
| 34 | Ga0207684_10055408 | 3300025910 | Unclassified | 3364 |
| 35 | Ga0207695_10277026 | 3300025913 | Bacteria | 1572 |
| 36 | Ga0207660_10301849 | 3300025917 | Bacteria | 1275 |
| 37 | Ga0207646_10057403 | 3300025922 | Bacteria | 3478 |
| 38 | Ga0207700_10044977 | 3300025928 | Plasmid | 3254 |
| 39 | Ga0207669_10329135 | 3300025937 | Bacteria | 1172 |
| 40 | Ga0207669_10399943 | 3300025937 | Bacteria | 1076 |
| 41 | Ga0207661_10026673 | 3300025944 | Bacteria | 4406 |
| 42 | Ga0207679_10028678 | 3300025945 | Bacteria | 3866 |
| 43 | Ga0209813_10209909 | 3300027866 | Bacteria | 724 |
| 44 | Ga0207428_10184742 | 3300027907 | Unclassified | 1574 |
| 45 | Ga0207428_10585875 | 3300027907 | Unclassified | 804 |
| 46 | Ga0268266_10137345 | 3300028379 | Bacteria | 2191 |
| 47 | Ga0265338_10003370 | 3300028800 | Bacteria | 22562 |
| 48 | Ga0265338_10038666 | 3300028800 | Bacteria | 4515 |
| 49 | Ga0307511_10002004 | 3300030521 | Bacteria | 21377 |
| 50 | Ga0265325_10004604 | 3300031241 | Bacteria | 8666 |
| 51 | Ga0265340_10162107 | 3300031247 | Unclassified | 1016 |
| 52 | Ga0265339_10019249 | 3300031249 | Bacteria | 4011 |
| 53 | Ga0265331_10019668 | 3300031250 | Bacteria | 3483 |
| 54 | Ga0307408_100442740 | 3300031548 | Bacteria | 1125 |
| 55 | Ga0265313_10000368 | 3300031595 | Bacteria | 48821 |
| 56 | Ga0307413_10056794 | 3300031824 | Bacteria | 2390 |
| 57 | Ga0307415_100302214 | 3300032126 | Bacteria | 1326 |
| 58 | Ga0436364_0116063 | 3300037853 | Bacteria | 34499 |
| 59 | Ga0436364_1349527 | 3300037853 | Bacteria | 624 |
| 60 | Ga0436365_1453254 | 3300039437 | Bacteria | 3203 |
| 61 | Ga0439436_0009962 | 3300041404 | Bacteria | 2906 |
| 62 | Ga0439439_0002963 | 3300041406 | Bacteria | 3690 |
| 63 | Ga0451797_1206281 | 3300041453 | Bacteria | 725 |
| 64 | Ga0451853_1799972 | 3300041512 | Bacteria | 710 |
| 65 | Ga0439433_0017036 | 3300041999 | Bacteria | 1611 |
| 66 | Ga0439449_0059360 | 3300042007 | Bacteria | 1412 |
| 67 | Ga0439457_000538 | 3300042014 | Bacteria | 11031 |
| 68 | Ga0450890_007086 | 3300042127 | Bacteria | 1430 |
| 69 | Ga0453683_0078914 | 3300044673 | Bacteria | 2061 |
| 70 | Ga0466960_0051605 | 3300044901 | Bacteria | 1988 |
| 71 | Ga0466960_0391586 | 3300044901 | Bacteria | 799 |
| 72 | Ga0451576_0012892 | 3300045051 | Bacteria | 9370 |
| 73 | Ga0451576_0218533 | 3300045051 | Bacteria | 1990 |
| 74 | Ga0466967_1027156 | 3300045976 | Bacteria | 821 |
| 75 | Ga0495629_0013800 | 3300046459 | Bacteria | 5828 |
| 76 | Ga0495662_0056663 | 3300046476 | Bacteria | 1893 |
| 77 | Ga0495594_0053061 | 3300046499 | Bacteria | 2232 |
| 78 | Ga0495606_0246916 | 3300046507 | Bacteria | 992 |
| 79 | Ga0495620_0051423 | 3300046515 | Bacteria | 1753 |
| 80 | Ga0495666_0007189 | 3300046526 | Bacteria | 5589 |
| 81 | Ga0495622_0013576 | 3300046557 | Bacteria | 3777 |
| 82 | Ga0495622_0091178 | 3300046557 | Bacteria | 1400 |
| 83 | Ga0495668_0000787 | 3300046616 | Bacteria | 36750 |
| 84 | Ga0495668_0116147 | 3300046616 | Bacteria | 1463 |
| 85 | Ga0495625_0002360 | 3300046660 | Bacteria | 20557 |
| 86 | Ga0495625_0050339 | 3300046660 | Bacteria | 2990 |
| 87 | Ga0495613_0156470 | 3300046689 | Bacteria | 1623 |
| 88 | Ga0495624_0009180 | 3300046690 | Bacteria | 6856 |
| 89 | Ga0495660_0024131 | 3300046810 | Bacteria | 3465 |
| 90 | Ga0495676_0003257 | 3300047321 | Bacteria | 14666 |
| 91 | Ga0495676_0084011 | 3300047321 | Bacteria | 2403 |
| 92 | Ga0495683_0346072 | 3300047323 | Bacteria | 628 |
| 93 | Ga0495685_048795 | 3300047447 | Bacteria | 1439 |
| 94 | Ga0495614_0008218 | 3300048089 | Bacteria | 4642 |
| 95 | Ga0495626_0000933 | 3300048091 | Bacteria | 25550 |
| 96 | Ga0496108_1332749 | 3300048911 | Unclassified | 603 |
| 97 | Ga0496112_0579256 | 3300048915 | Bacteria | 1055 |
| 98 | Ga0501033_0318618 | 3300049570 | Bacteria | 1092 |
| 99 | Ga0501034_0857207 | 3300049571 | Bacteria | 798 |
| 100 | Ga0501038_0416432 | 3300049574 | Bacteria | 1037 |
| 101 | Ga0501038_0645735 | 3300049574 | Unclassified | 797 |
| 102 | Ga0501040_0129340 | 3300049576 | Bacteria | 1775 |
| 103 | Ga0501040_0163792 | 3300049576 | Unclassified | 1573 |
| 104 | Ga0501041_0234346 | 3300049577 | Bacteria | 1153 |
| 105 | Ga0501046_0074043 | 3300049580 | Bacteria | 2642 |
| 106 | Ga0501047_0015104 | 3300049581 | Bacteria | 7352 |
| 107 | Ga0501047_0163593 | 3300049581 | Bacteria | 2096 |
| 108 | Ga0501070_0814795 | 3300049586 | Bacteria | 732 |
| 109 | Ga0501074_0742837 | 3300049590 | Bacteria | 692 |
| 110 | Ga0501075_0374123 | 3300049591 | Bacteria | 1086 |
| 111 | Ga0501076_0628849 | 3300049592 | Bacteria | 886 |
| 112 | Ga0501083_0119725 | 3300049744 | Unclassified | 1727 |
| 113 | Ga0501035_0106591 | 3300049822 | Bacteria | 2457 |
| 114 | Ga0501044_0185715 | 3300049823 | Bacteria | 2044 |
| 115 | Ga0501045_0363434 | 3300049824 | Bacteria | 1077 |
| 116 | nmdc:mga04h51_358540_c1 | 3300050495 | Bacteria | 604 |
| 117 | nmdc:mga05p37_42150_c1 | 3300050507 | Bacteria | 5608 |
| 118 | nmdc:mga05p37_76307_c1 | 3300050507 | Bacteria | 4127 |
| 119 | nmdc:mga09592_56240_c1 | 3300050508 | Bacteria | 3325 |
| 120 | nmdc:mga0qj67_304089_c1 | 3300050509 | Bacteria | 1292 |
| 121 | nmdc:mga0qj67_478350_c1 | 3300050509 | Bacteria | 1002 |
| 122 | nmdc:mga0qj67_65018_c1 | 3300050509 | Bacteria | 2903 |
| 123 | nmdc:mga06r32_17673_c1 | 3300050510 | Bacteria | 6514 |
| 124 | nmdc:mga06r32_179394_c1 | 3300050510 | Bacteria | 2103 |
| 125 | nmdc:mga08y16_181547_c1 | 3300050511 | Unclassified | 2185 |
| 126 | nmdc:mga08y16_99428_c1 | 3300050511 | Bacteria | 3029 |
| 127 | nmdc:mga0n895_1298538_c1 | 3300050512 | Unclassified | 699 |
| 128 | Ga0500658_0021636 | 3300053134 | Bacteria | 2438 |
| 129 | Ga0500568_0012692 | 3300053139 | Bacteria | 3865 |
| 130 | Ga0500568_0044085 | 3300053139 | Bacteria | 1780 |
| 131 | 2616553570 | 2615840698 | Bacteria | 7319877 |
| 132 | 2644268616 | 2643221647 | Bacteria | 10741251 |
| 133 | 2785342578 | 2784746763 | Bacteria | 9783172 |
| 134 | 2835320046 | 2835312727 | Bacteria | 7413381 |
| 135 | 2841766072 | 2841760612 | Bacteria | 6454112 |
| 136 | 2841911409 | 2841911363 | Bacteria | 6173697 |
| 137 | 2841917872 | 2841917233 | Bacteria | 6173500 |
| 138 | 2842751489 | 2842747753 | Bacteria | 5578255 |
| 139 | 2844105838 | 2844104063 | Bacteria | 6440972 |
| 140 | 2851186336 | 2851182111 | Bacteria | 6047226 |
| 141 | 2851246194 | 2851246043 | Bacteria | 6439203 |
| 142 | 2857463718 | 2857460504 | Bacteria | 5194327 |
| 143 | 8057531583 | 8057529695 | Bacteria | 6306553 |
| 144 | Ga0307416_100616850 | |||
| 145 | Ga0058859_11368413 | |||
| 146 | Ga0058860_12103785 | |||
| 147 | Ga0070683_100116310 | |||
| 148 | Ga0070680_100060185 | |||
| 149 | Ga0070706_100019686 | |||
| 150 | Ga0070707_100026603 | |||
| 151 | Ga0070698_100190265 | |||
| 152 | Ga0070684_100257339 | |||
| 153 | Ga0068853_100754665 | |||
| 154 | Ga0068855_101022251 | |||
| 155 | Ga0081539_10000449 | |||
| 156 | Ga0075368_10274671 | |||
| 157 | Ga0075428_100058695 | |||
| 158 | Ga0075428_100350518 | |||
| 159 | Ga0075428_101710413 | |||
| 160 | Ga0075430_100574513 | |||
| 161 | Ga0075431_100020955 | |||
| 162 | Ga0075434_101263461 | |||
| 163 | Ga0075429_100063767 | |||
| 164 | Ga0075429_100907170 | |||
| 165 | Ga0111539_10114702 | |||
| 166 | Ga0111539_10446403 | |||
| 167 | Ga0105245_10653902 | |||
| 168 | Ga0114129_10207347 | |||
| 169 | Ga0114129_10568769 | |||
| 170 | Ga0105237_10761435 | |||
| 171 | Ga0105239_10086549 | |||
| 172 | Ga0157370_11077065 | |||
| 173 | Ga0157380_10292762 | |||
| 174 | Ga0157379_10648164 | |||
| 175 | Ga0213875_10000498 | |||
| 176 | Ga0207684_10014987 | |||
| 177 | Ga0207684_10055408 | |||
| 178 | Ga0207695_10277026 | |||
| 179 | Ga0207660_10301849 | |||
| 180 | Ga0207646_10057403 | |||
| 181 | Ga0207700_10044977 | |||
| 182 | Ga0207669_10329135 | |||
| 183 | Ga0207669_10399943 | |||
| 184 | Ga0207661_10026673 | |||
| 185 | Ga0207679_10028678 | |||
| 186 | Ga0209813_10209909 | |||
| 187 | Ga0207428_10184742 | |||
| 188 | Ga0207428_10585875 | |||
| 189 | Ga0268266_10137345 | |||
| 190 | Ga0265338_10003370 | |||
| 191 | Ga0265338_10038666 | |||
| 192 | Ga0307511_10002004 | |||
| 193 | Ga0265325_10004604 | |||
| 194 | Ga0265340_10162107 | |||
| 195 | Ga0265339_10019249 | |||
| 196 | Ga0265331_10019668 | |||
| 197 | Ga0307408_100442740 | |||
| 198 | Ga0265313_10000368 | |||
| 199 | Ga0307413_10056794 | |||
| 200 | Ga0307415_100302214 | |||
| 201 | Ga0436364_0116063 | |||
| 202 | Ga0436364_1349527 | |||
| 203 | Ga0436365_1453254 | |||
| 204 | Ga0439436_0009962 | |||
| 205 | Ga0439439_0002963 | |||
| 206 | Ga0451797_1206281 | |||
| 207 | Ga0451853_1799972 | |||
| 208 | Ga0439433_0017036 | |||
| 209 | Ga0439449_0059360 | |||
| 210 | Ga0439457_000538 | |||
| 211 | Ga0450890_007086 | |||
| 212 | Ga0453683_0078914 | |||
| 213 | Ga0466960_0051605 | |||
| 214 | Ga0466960_0391586 | |||
| 215 | Ga0451576_0012892 | |||
| 216 | Ga0451576_0218533 | |||
| 217 | Ga0466967_1027156 | |||
| 218 | Ga0495629_0013800 | |||
| 219 | Ga0495662_0056663 | |||
| 220 | Ga0495594_0053061 | |||
| 221 | Ga0495606_0246916 | |||
| 222 | Ga0495620_0051423 | |||
| 223 | Ga0495666_0007189 | |||
| 224 | Ga0495622_0013576 | |||
| 225 | Ga0495622_0091178 | |||
| 226 | Ga0495668_0000787 | |||
| 227 | Ga0495668_0116147 | |||
| 228 | Ga0495625_0002360 | |||
| 229 | Ga0495625_0050339 | |||
| 230 | Ga0495613_0156470 | |||
| 231 | Ga0495624_0009180 | |||
| 232 | Ga0495660_0024131 | |||
| 233 | Ga0495676_0003257 | |||
| 234 | Ga0495676_0084011 | |||
| 235 | Ga0495683_0346072 | |||
| 236 | Ga0495685_048795 | |||
| 237 | Ga0495614_0008218 | |||
| 238 | Ga0495626_0000933 | |||
| 239 | Ga0496108_1332749 | |||
| 240 | Ga0496112_0579256 | |||
| 241 | Ga0501033_0318618 | |||
| 242 | Ga0501034_0857207 | |||
| 243 | Ga0501038_0416432 | |||
| 244 | Ga0501038_0645735 | |||
| 245 | Ga0501040_0129340 | |||
| 246 | Ga0501040_0163792 | |||
| 247 | Ga0501041_0234346 | |||
| 248 | Ga0501046_0074043 | |||
| 249 | Ga0501047_0015104 | |||
| 250 | Ga0501047_0163593 | |||
| 251 | Ga0501070_0814795 | |||
| 252 | Ga0501074_0742837 | |||
| 253 | Ga0501075_0374123 | |||
| 254 | Ga0501076_0628849 | |||
| 255 | Ga0501083_0119725 | |||
| 256 | Ga0501035_0106591 | |||
| 257 | Ga0501044_0185715 | |||
| 258 | Ga0501045_0363434 | |||
| 259 | nmdc:mga04h51_358540_c1 | |||
| 260 | nmdc:mga05p37_42150_c1 | |||
| 261 | nmdc:mga05p37_76307_c1 | |||
| 262 | nmdc:mga09592_56240_c1 | |||
| 263 | nmdc:mga0qj67_304089_c1 | |||
| 264 | nmdc:mga0qj67_478350_c1 | |||
| 265 | nmdc:mga0qj67_65018_c1 | |||
| 266 | nmdc:mga06r32_17673_c1 | |||
| 267 | nmdc:mga06r32_179394_c1 | |||
| 268 | nmdc:mga08y16_181547_c1 | |||
| 269 | nmdc:mga08y16_99428_c1 | |||
| 270 | nmdc:mga0n895_1298538_c1 | |||
| 271 | Ga0500658_0021636 | |||
| 272 | Ga0500568_0012692 | |||
| 273 | Ga0500568_0044085 | |||
| 274 | 2616553570 | |||
| 275 | 2644268616 | |||
| 276 | 2785342578 | |||
| 277 | 2835320046 | |||
| 278 | 2841766072 | |||
| 279 | 2841911409 | |||
| 280 | 2841917872 | |||
| 281 | 2842751489 | |||
| 282 | 2844105838 | |||
| 283 | 2851186336 | |||
| 284 | 2851246194 | |||
| 285 | 2857463718 | |||
| 286 | 8057531583 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1oru-assembly1.cif.gz_B | crystal structure of apc1665, yuad protein from bacillus subtilis | 0.8065 | 1 | 167 |
| 3srf-assembly2.cif.gz_G | human m1 pyruvate kinase | 0.7913 | 87 | 167 |
| 8iav-assembly1.cif.gz_D | crystal structure of streptococcus pneumoniae pyruvate kinase in complex with fructose 1,6-bisphosphate | 0.7846 | 97 | 167 |
| 5yhi-assembly1.cif.gz_B | crystal structure of yiim from escherichia coli | 0.7812 | 1 | 175 |
| 6v76-assembly1.cif.gz_B | crystal structure of human pkm2 in complex with l-valine | 0.7744 | 87 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1oruB00 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.7946 | 2 | 171 | 2.40.33.20 |
| 1oruB00 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.7654 | 2 | 171 | 2.40.33.20 |
| 4cd4A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7534 | 132 | 145 | 3.20.20.80 |
| 5yhiA00 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.7493 | 1 | 175 | 2.40.33.20 |
| af_P95151_15_247_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.7336 | 3 | 176 | 2.40.33.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0N8KLX8-F1-model_v4 | Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI | 1.001 | 3 | 180 |
GO:0003824
GO:0019634 GO:0030151 GO:0030170 |
| AF-A0A6B2TSH5-F1-model_v4 | deleted | 0.9998 | 4 | 180 |
|
| AF-A0A800F6E5-F1-model_v4 | Aminoglycoside N(3)-acetyltransferase (EC 2.3.1.-) | 0.9996 | 2 | 180 |
GO:0008080
GO:0030151 GO:0030170 GO:0046677 |
| AF-A0A4Q3P7J3-F1-model_v4 | deleted | 0.9991 | 3 | 115 |
|
| AF-A0A3M8DDJ5-F1-model_v4 | GNAT family N-acetyltransferase | 0.9985 | 2 | 180 |
GO:0016747
GO:0030151 GO:0030170 |