F189265

General Info

Members Datasets Scaffolds Average Seq Length
143 118 286 182

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100616850|Ga0307416_1006168502
Length 190
Sequence VTSEPSPAGKPAVVVAVSRDPEHRMSKVNEPRIRLLEGLGVEGDAHLGRTVQHRSRVARDPTEPNLRQVHLIHEELHDELRGRGFAVVAPGVMGENVTTRGVDLLGLPTGTRLTLGGAAVVEITGLRNPCVQLDGLQPGLMSAVLDRDEDGKLIRRSGVMGIVLTGGDVSPGDPIAVELPPPPHRPLEKV

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
37 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
41 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
42 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
43 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
44 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
47 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
52 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
53 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
59 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
60 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
65 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
68 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
69 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
74 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
75 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
76 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
77 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
78 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
79 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
80 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
97 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
105 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
106 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
107 2643221647 Streptomyces sp. Root369 Isolate Unclassified
108 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
109 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
110 2841760612 Bosea sp. Tri-49 Isolate Nodule
111 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
112 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
113 2842747753 Variovorax sp. R-72060 Isolate Unclassified
114 2844104063 Bosea sp. Tri-39 Isolate Nodule
115 2851182111 Bosea sp. Tri-44 Isolate Nodule
116 2851246043 Bosea sp. Tri-54 Isolate Nodule
117 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
118 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.51
Metatranscriptomes 1.4
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.2
Nodule 6.29
Rhizoplane 2.1
Rhizosphere 79.02
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100616850 3300032002 Bacteria 1166
2 Ga0058859_11368413 3300004798 Bacteria 1258
3 Ga0058860_12103785 3300004801 Bacteria 1416
4 Ga0070683_100116310 3300005329 Bacteria 2524
5 Ga0070680_100060185 3300005336 Bacteria 3108
6 Ga0070706_100019686 3300005467 Bacteria 6224
7 Ga0070707_100026603 3300005468 Bacteria 5495
8 Ga0070698_100190265 3300005471 Bacteria 1990
9 Ga0070684_100257339 3300005535 Bacteria 1596
10 Ga0068853_100754665 3300005539 Bacteria 930
11 Ga0068855_101022251 3300005563 Bacteria 867
12 Ga0081539_10000449 3300005985 Bacteria 87716
13 Ga0075368_10274671 3300006042 Bacteria 723
14 Ga0075428_100058695 3300006844 Bacteria 4212
15 Ga0075428_100350518 3300006844 Bacteria 1584
16 Ga0075428_101710413 3300006844 Bacteria 656
17 Ga0075430_100574513 3300006846 Unclassified 930
18 Ga0075431_100020955 3300006847 Bacteria 6680
19 Ga0075434_101263461 3300006871 Bacteria 750
20 Ga0075429_100063767 3300006880 Bacteria 3210
21 Ga0075429_100907170 3300006880 Bacteria 771
22 Ga0111539_10114702 3300009094 Bacteria 3160
23 Ga0111539_10446403 3300009094 Bacteria 1506
24 Ga0105245_10653902 3300009098 Bacteria 1081
25 Ga0114129_10207347 3300009147 Bacteria 2651
26 Ga0114129_10568769 3300009147 Bacteria 1472
27 Ga0105237_10761435 3300009545 Unclassified 975
28 Ga0105239_10086549 3300010375 Bacteria 3454
29 Ga0157370_11077065 3300013104 Bacteria 726
30 Ga0157380_10292762 3300014326 Unclassified 1496
31 Ga0157379_10648164 3300014968 Bacteria 989
32 Ga0213875_10000498 3300021388 Bacteria 32954
33 Ga0207684_10014987 3300025910 Bacteria 6673
34 Ga0207684_10055408 3300025910 Unclassified 3364
35 Ga0207695_10277026 3300025913 Bacteria 1572
36 Ga0207660_10301849 3300025917 Bacteria 1275
37 Ga0207646_10057403 3300025922 Bacteria 3478
38 Ga0207700_10044977 3300025928 Plasmid 3254
39 Ga0207669_10329135 3300025937 Bacteria 1172
40 Ga0207669_10399943 3300025937 Bacteria 1076
41 Ga0207661_10026673 3300025944 Bacteria 4406
42 Ga0207679_10028678 3300025945 Bacteria 3866
43 Ga0209813_10209909 3300027866 Bacteria 724
44 Ga0207428_10184742 3300027907 Unclassified 1574
45 Ga0207428_10585875 3300027907 Unclassified 804
46 Ga0268266_10137345 3300028379 Bacteria 2191
47 Ga0265338_10003370 3300028800 Bacteria 22562
48 Ga0265338_10038666 3300028800 Bacteria 4515
49 Ga0307511_10002004 3300030521 Bacteria 21377
50 Ga0265325_10004604 3300031241 Bacteria 8666
51 Ga0265340_10162107 3300031247 Unclassified 1016
52 Ga0265339_10019249 3300031249 Bacteria 4011
53 Ga0265331_10019668 3300031250 Bacteria 3483
54 Ga0307408_100442740 3300031548 Bacteria 1125
55 Ga0265313_10000368 3300031595 Bacteria 48821
56 Ga0307413_10056794 3300031824 Bacteria 2390
57 Ga0307415_100302214 3300032126 Bacteria 1326
58 Ga0436364_0116063 3300037853 Bacteria 34499
59 Ga0436364_1349527 3300037853 Bacteria 624
60 Ga0436365_1453254 3300039437 Bacteria 3203
61 Ga0439436_0009962 3300041404 Bacteria 2906
62 Ga0439439_0002963 3300041406 Bacteria 3690
63 Ga0451797_1206281 3300041453 Bacteria 725
64 Ga0451853_1799972 3300041512 Bacteria 710
65 Ga0439433_0017036 3300041999 Bacteria 1611
66 Ga0439449_0059360 3300042007 Bacteria 1412
67 Ga0439457_000538 3300042014 Bacteria 11031
68 Ga0450890_007086 3300042127 Bacteria 1430
69 Ga0453683_0078914 3300044673 Bacteria 2061
70 Ga0466960_0051605 3300044901 Bacteria 1988
71 Ga0466960_0391586 3300044901 Bacteria 799
72 Ga0451576_0012892 3300045051 Bacteria 9370
73 Ga0451576_0218533 3300045051 Bacteria 1990
74 Ga0466967_1027156 3300045976 Bacteria 821
75 Ga0495629_0013800 3300046459 Bacteria 5828
76 Ga0495662_0056663 3300046476 Bacteria 1893
77 Ga0495594_0053061 3300046499 Bacteria 2232
78 Ga0495606_0246916 3300046507 Bacteria 992
79 Ga0495620_0051423 3300046515 Bacteria 1753
80 Ga0495666_0007189 3300046526 Bacteria 5589
81 Ga0495622_0013576 3300046557 Bacteria 3777
82 Ga0495622_0091178 3300046557 Bacteria 1400
83 Ga0495668_0000787 3300046616 Bacteria 36750
84 Ga0495668_0116147 3300046616 Bacteria 1463
85 Ga0495625_0002360 3300046660 Bacteria 20557
86 Ga0495625_0050339 3300046660 Bacteria 2990
87 Ga0495613_0156470 3300046689 Bacteria 1623
88 Ga0495624_0009180 3300046690 Bacteria 6856
89 Ga0495660_0024131 3300046810 Bacteria 3465
90 Ga0495676_0003257 3300047321 Bacteria 14666
91 Ga0495676_0084011 3300047321 Bacteria 2403
92 Ga0495683_0346072 3300047323 Bacteria 628
93 Ga0495685_048795 3300047447 Bacteria 1439
94 Ga0495614_0008218 3300048089 Bacteria 4642
95 Ga0495626_0000933 3300048091 Bacteria 25550
96 Ga0496108_1332749 3300048911 Unclassified 603
97 Ga0496112_0579256 3300048915 Bacteria 1055
98 Ga0501033_0318618 3300049570 Bacteria 1092
99 Ga0501034_0857207 3300049571 Bacteria 798
100 Ga0501038_0416432 3300049574 Bacteria 1037
101 Ga0501038_0645735 3300049574 Unclassified 797
102 Ga0501040_0129340 3300049576 Bacteria 1775
103 Ga0501040_0163792 3300049576 Unclassified 1573
104 Ga0501041_0234346 3300049577 Bacteria 1153
105 Ga0501046_0074043 3300049580 Bacteria 2642
106 Ga0501047_0015104 3300049581 Bacteria 7352
107 Ga0501047_0163593 3300049581 Bacteria 2096
108 Ga0501070_0814795 3300049586 Bacteria 732
109 Ga0501074_0742837 3300049590 Bacteria 692
110 Ga0501075_0374123 3300049591 Bacteria 1086
111 Ga0501076_0628849 3300049592 Bacteria 886
112 Ga0501083_0119725 3300049744 Unclassified 1727
113 Ga0501035_0106591 3300049822 Bacteria 2457
114 Ga0501044_0185715 3300049823 Bacteria 2044
115 Ga0501045_0363434 3300049824 Bacteria 1077
116 nmdc:mga04h51_358540_c1 3300050495 Bacteria 604
117 nmdc:mga05p37_42150_c1 3300050507 Bacteria 5608
118 nmdc:mga05p37_76307_c1 3300050507 Bacteria 4127
119 nmdc:mga09592_56240_c1 3300050508 Bacteria 3325
120 nmdc:mga0qj67_304089_c1 3300050509 Bacteria 1292
121 nmdc:mga0qj67_478350_c1 3300050509 Bacteria 1002
122 nmdc:mga0qj67_65018_c1 3300050509 Bacteria 2903
123 nmdc:mga06r32_17673_c1 3300050510 Bacteria 6514
124 nmdc:mga06r32_179394_c1 3300050510 Bacteria 2103
125 nmdc:mga08y16_181547_c1 3300050511 Unclassified 2185
126 nmdc:mga08y16_99428_c1 3300050511 Bacteria 3029
127 nmdc:mga0n895_1298538_c1 3300050512 Unclassified 699
128 Ga0500658_0021636 3300053134 Bacteria 2438
129 Ga0500568_0012692 3300053139 Bacteria 3865
130 Ga0500568_0044085 3300053139 Bacteria 1780
131 2616553570 2615840698 Bacteria 7319877
132 2644268616 2643221647 Bacteria 10741251
133 2785342578 2784746763 Bacteria 9783172
134 2835320046 2835312727 Bacteria 7413381
135 2841766072 2841760612 Bacteria 6454112
136 2841911409 2841911363 Bacteria 6173697
137 2841917872 2841917233 Bacteria 6173500
138 2842751489 2842747753 Bacteria 5578255
139 2844105838 2844104063 Bacteria 6440972
140 2851186336 2851182111 Bacteria 6047226
141 2851246194 2851246043 Bacteria 6439203
142 2857463718 2857460504 Bacteria 5194327
143 8057531583 8057529695 Bacteria 6306553
144 Ga0307416_100616850
145 Ga0058859_11368413
146 Ga0058860_12103785
147 Ga0070683_100116310
148 Ga0070680_100060185
149 Ga0070706_100019686
150 Ga0070707_100026603
151 Ga0070698_100190265
152 Ga0070684_100257339
153 Ga0068853_100754665
154 Ga0068855_101022251
155 Ga0081539_10000449
156 Ga0075368_10274671
157 Ga0075428_100058695
158 Ga0075428_100350518
159 Ga0075428_101710413
160 Ga0075430_100574513
161 Ga0075431_100020955
162 Ga0075434_101263461
163 Ga0075429_100063767
164 Ga0075429_100907170
165 Ga0111539_10114702
166 Ga0111539_10446403
167 Ga0105245_10653902
168 Ga0114129_10207347
169 Ga0114129_10568769
170 Ga0105237_10761435
171 Ga0105239_10086549
172 Ga0157370_11077065
173 Ga0157380_10292762
174 Ga0157379_10648164
175 Ga0213875_10000498
176 Ga0207684_10014987
177 Ga0207684_10055408
178 Ga0207695_10277026
179 Ga0207660_10301849
180 Ga0207646_10057403
181 Ga0207700_10044977
182 Ga0207669_10329135
183 Ga0207669_10399943
184 Ga0207661_10026673
185 Ga0207679_10028678
186 Ga0209813_10209909
187 Ga0207428_10184742
188 Ga0207428_10585875
189 Ga0268266_10137345
190 Ga0265338_10003370
191 Ga0265338_10038666
192 Ga0307511_10002004
193 Ga0265325_10004604
194 Ga0265340_10162107
195 Ga0265339_10019249
196 Ga0265331_10019668
197 Ga0307408_100442740
198 Ga0265313_10000368
199 Ga0307413_10056794
200 Ga0307415_100302214
201 Ga0436364_0116063
202 Ga0436364_1349527
203 Ga0436365_1453254
204 Ga0439436_0009962
205 Ga0439439_0002963
206 Ga0451797_1206281
207 Ga0451853_1799972
208 Ga0439433_0017036
209 Ga0439449_0059360
210 Ga0439457_000538
211 Ga0450890_007086
212 Ga0453683_0078914
213 Ga0466960_0051605
214 Ga0466960_0391586
215 Ga0451576_0012892
216 Ga0451576_0218533
217 Ga0466967_1027156
218 Ga0495629_0013800
219 Ga0495662_0056663
220 Ga0495594_0053061
221 Ga0495606_0246916
222 Ga0495620_0051423
223 Ga0495666_0007189
224 Ga0495622_0013576
225 Ga0495622_0091178
226 Ga0495668_0000787
227 Ga0495668_0116147
228 Ga0495625_0002360
229 Ga0495625_0050339
230 Ga0495613_0156470
231 Ga0495624_0009180
232 Ga0495660_0024131
233 Ga0495676_0003257
234 Ga0495676_0084011
235 Ga0495683_0346072
236 Ga0495685_048795
237 Ga0495614_0008218
238 Ga0495626_0000933
239 Ga0496108_1332749
240 Ga0496112_0579256
241 Ga0501033_0318618
242 Ga0501034_0857207
243 Ga0501038_0416432
244 Ga0501038_0645735
245 Ga0501040_0129340
246 Ga0501040_0163792
247 Ga0501041_0234346
248 Ga0501046_0074043
249 Ga0501047_0015104
250 Ga0501047_0163593
251 Ga0501070_0814795
252 Ga0501074_0742837
253 Ga0501075_0374123
254 Ga0501076_0628849
255 Ga0501083_0119725
256 Ga0501035_0106591
257 Ga0501044_0185715
258 Ga0501045_0363434
259 nmdc:mga04h51_358540_c1
260 nmdc:mga05p37_42150_c1
261 nmdc:mga05p37_76307_c1
262 nmdc:mga09592_56240_c1
263 nmdc:mga0qj67_304089_c1
264 nmdc:mga0qj67_478350_c1
265 nmdc:mga0qj67_65018_c1
266 nmdc:mga06r32_17673_c1
267 nmdc:mga06r32_179394_c1
268 nmdc:mga08y16_181547_c1
269 nmdc:mga08y16_99428_c1
270 nmdc:mga0n895_1298538_c1
271 Ga0500658_0021636
272 Ga0500568_0012692
273 Ga0500568_0044085
274 2616553570
275 2644268616
276 2785342578
277 2835320046
278 2841766072
279 2841911409
280 2841917872
281 2842751489
282 2844105838
283 2851186336
284 2851246194
285 2857463718
286 8057531583

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

44

176

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.8065 1 167
3srf-assembly2.cif.gz_G human m1 pyruvate kinase 0.7913 87 167
8iav-assembly1.cif.gz_D crystal structure of streptococcus pneumoniae pyruvate kinase in complex with fructose 1,6-bisphosphate 0.7846 97 167
5yhi-assembly1.cif.gz_B crystal structure of yiim from escherichia coli 0.7812 1 175
6v76-assembly1.cif.gz_B crystal structure of human pkm2 in complex with l-valine 0.7744 87 167
ID Description Score Start End Superfamily
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7946 2 171 2.40.33.20
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7654 2 171 2.40.33.20
4cd4A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7534 132 145 3.20.20.80
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7493 1 175 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7336 3 176 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A0N8KLX8-F1-model_v4 Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI 1.001 3 180 GO:0003824
GO:0019634
GO:0030151
GO:0030170
AF-A0A6B2TSH5-F1-model_v4 deleted 0.9998 4 180
AF-A0A800F6E5-F1-model_v4 Aminoglycoside N(3)-acetyltransferase (EC 2.3.1.-) 0.9996 2 180 GO:0008080
GO:0030151
GO:0030170
GO:0046677
AF-A0A4Q3P7J3-F1-model_v4 deleted 0.9991 3 115
AF-A0A3M8DDJ5-F1-model_v4 GNAT family N-acetyltransferase 0.9985 2 180 GO:0016747
GO:0030151
GO:0030170

Map