F188443

General Info

Members Datasets Scaffolds Average Seq Length
143 119 138 357

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100015220|Ga0075431_1000152202
Length 403
Sequence MRDHPPRFRVAHGNTVCPQVRSEIVGKQAEEMRVHVAPRIFYYSSPGMIRTVISATGSHIPTVRVPNEHFLGYDFRGTDQQPLNKTNDEILKQFESITGIRERRYAPDEMMTSDIAYEAARDAIDSSGIDPESLDGIIVAHNFGDVRAGNPRSDMVPALAARVKSRLGIRNPYAAAFDLVFGCPGWLQGVIVADSMIRAGDNKRVMIIGADTLSRISDPHDRDSLIYADGAGAVIVEGRETTDDVGILSRAVRSDTLEHSQMLFMGTSYNPEAFLEALFLKMEGRKLYKYALNNVAGAIREALVRANVDLRDVKKVLIHQANGKMDEAILNATYELYGISDPPHDVMPMTISWLGNSSVATVPTLLDLILKQKMDGHAITKGDVVVFASVGAGMHINAVVYRF

Samples

Sample ID Description Type Environment
1 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
5 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
87 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
90 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
91 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
92 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 0
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.2
Nodule 0
Rhizoplane 0.7
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 10.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10308059 3300003323 Bacteria 1364
2 Ga0070658_10039387 3300005327 Bacteria 3812
3 Ga0070683_100000050 3300005329 Bacteria 90949
4 Ga0070670_100000184 3300005331 Bacteria 56897
5 Ga0068869_100010382 3300005334 Bacteria 6073
6 Ga0070682_100000002 3300005337 Bacteria 506802
7 Ga0068868_100000068 3300005338 Bacteria 59767
8 Ga0068868_100003274 3300005338 Bacteria 11269
9 Ga0070689_100026999 3300005340 Bacteria 4327
10 Ga0070689_100284607 3300005340 Unclassified 1372
11 Ga0070687_100041900 3300005343 Bacteria 2317
12 Ga0070692_10010286 3300005345 Bacteria 4252
13 Ga0070675_100000018 3300005354 Bacteria 178025
14 Ga0070700_100000152 3300005441 Bacteria 40402
15 Ga0070663_100002978 3300005455 Bacteria 9655
16 Ga0070706_100017070 3300005467 Bacteria 6706
17 Ga0070706_100116977 3300005467 Bacteria 2483
18 Ga0070707_100037024 3300005468 Bacteria 4655
19 Ga0070698_100055617 3300005471 Unclassified 4011
20 Ga0070698_100187104 3300005471 Bacteria 2008
21 Ga0070699_100017010 3300005518 Bacteria 6244
22 Ga0070684_100000078 3300005535 Bacteria 64139
23 Ga0068853_100047040 3300005539 Bacteria 3702
24 Ga0070672_100004782 3300005543 Bacteria 8888
25 Ga0070693_100042320 3300005547 Bacteria 2566
26 Ga0068854_100039109 3300005578 Bacteria 3339
27 Ga0068864_100000166 3300005618 Bacteria 60717
28 Ga0068861_100032910 3300005719 Bacteria 3821
29 Ga0068858_100000173 3300005842 Bacteria 68371
30 Ga0070717_10000097 3300006028 Bacteria 67987
31 Ga0070716_100037604 3300006173 Bacteria 2676
32 Ga0075366_10061782 3300006195 Bacteria 2227
33 Ga0075370_10056738 3300006353 Unclassified 2226
34 Ga0075428_100009054 3300006844 Bacteria 11046
35 Ga0075430_100026964 3300006846 Bacteria 4886
36 Ga0075431_100015220 3300006847 Bacteria 7795
37 Ga0075434_100130461 3300006871 Bacteria 2532
38 Ga0075429_100031363 3300006880 Bacteria 4619
39 Ga0075436_100003381 3300006914 Bacteria 10928
40 Ga0075435_100000040 3300007076 Bacteria 66678
41 Ga0075435_100033306 3300007076 Bacteria 4073
42 Ga0075435_100055518 3300007076 Bacteria 3199
43 Ga0111539_10000017 3300009094 Bacteria 275456
44 Ga0105245_10000003 3300009098 Bacteria 488207
45 Ga0105245_10001765 3300009098 Bacteria 19710
46 Ga0105245_10002524 3300009098 Bacteria 16507
47 Ga0114129_10515278 3300009147 Bacteria 1560
48 Ga0105242_10005868 3300009176 Bacteria 9462
49 Ga0105237_10010241 3300009545 Bacteria 9989
50 Ga0105238_10000115 3300009551 Bacteria 89300
51 Ga0105239_10026658 3300010375 Bacteria 6361
52 Ga0157371_10002954 3300013102 Bacteria 15818
53 Ga0157369_10000166 3300013105 Bacteria 93696
54 Ga0157369_10016904 3300013105 Bacteria 8199
55 Ga0157374_10000006 3300013296 Bacteria 640284
56 Ga0157378_10000013 3300013297 Bacteria 151930
57 Ga0157378_10000310 3300013297 Bacteria 47609
58 Ga0157372_10000010 3300013307 Bacteria 300658
59 Ga0157375_10000009 3300013308 Bacteria 366440
60 Ga0157375_10000245 3300013308 Bacteria 49837
61 Ga0157375_10001126 3300013308 Bacteria 23143
62 Ga0157380_10016599 3300014326 Bacteria 5434
63 Ga0157377_10000003 3300014745 Bacteria 435133
64 Ga0157376_10000009 3300014969 Bacteria 340244
65 Ga0182005_1000216 3300015265 Bacteria 38130
66 Ga0213873_10000001 3300021358 Bacteria 1657979
67 Ga0213876_10000002 3300021384 Bacteria 1168769
68 Ga0213876_10006689 3300021384 Bacteria 6292
69 Ga0209436_102390 3300025208 Bacteria 5687
70 Ga0207426_1004164 3300025302 Bacteria 7229
71 Ga0207684_10036698 3300025910 Bacteria 4160
72 Ga0207671_10000149 3300025914 Bacteria 107722
73 Ga0207662_10046368 3300025918 Bacteria 2571
74 Ga0207646_10146480 3300025922 Bacteria 2128
75 Ga0207694_10000001 3300025924 Bacteria 4078485
76 Ga0207650_10000070 3300025925 Bacteria 138201
77 Ga0207659_10000025 3300025926 Bacteria 139965
78 Ga0207687_10000002 3300025927 Bacteria 975489
79 Ga0207687_10001109 3300025927 Bacteria 18296
80 Ga0207700_10021622 3300025928 Bacteria 4397
81 Ga0207686_10002033 3300025934 Bacteria 11152
82 Ga0207670_10006179 3300025936 Bacteria 6626
83 Ga0207691_10000675 3300025940 Bacteria 33714
84 Ga0207689_10003392 3300025942 Bacteria 14556
85 Ga0207661_10000013 3300025944 Bacteria 348811
86 Ga0207640_10020842 3300025981 Bacteria 3897
87 Ga0207640_10021539 3300025981 Bacteria 3844
88 Ga0207677_10000006 3300026023 Bacteria 283855
89 Ga0207677_10000077 3300026023 Bacteria 80916
90 Ga0207703_10000211 3300026035 Bacteria 68033
91 Ga0207708_10000007 3300026075 Bacteria 264612
92 Ga0207676_10000136 3300026095 Bacteria 64065
93 Ga0207683_10125502 3300026121 Unclassified 2306
94 Ga0207428_10000010 3300027907 Bacteria 397329
95 Ga0307511_10001815 3300030521 Bacteria 22440
96 Ga0265316_10130290 3300031344 Bacteria 1895
97 Ga0316575_10000546 3300031665 Bacteria 11035
98 Ga0316579_10014824 3300031691 Bacteria 3378
99 Ga0316579_10071694 3300031691 Bacteria 1642
100 Ga0316576_10261730 3300031727 Bacteria 1298
101 Ga0316578_10061445 3300031728 Bacteria 2214
102 Ga0316578_10076001 3300031728 Bacteria 1993
103 Ga0316577_10013531 3300031733 Bacteria 4464
104 Ga0316577_10069256 3300031733 Unclassified 1971
105 Ga0316583_10010978 3300032133 Bacteria 3262
106 Ga0316585_10004679 3300032137 Bacteria 3829
107 Ga0316574_0000441 3300035398 Bacteria 16524
108 Ga0316582_0000857 3300036647 Bacteria 12383
109 Ga0316584_0005844 3300036712 Bacteria 8306
110 Ga0316584_0051617 3300036712 Bacteria 3075
111 Ga0395899_0000744 3300037312 Bacteria 32507
112 Ga0436365_0414850 3300039437 Bacteria 153664
113 Ga0436365_0862132 3300039437 Bacteria 257735
114 Ga0436365_1505044 3300039437 Bacteria 7707
115 Ga0436362_0842419 3300039453 Bacteria 317447
116 Ga0436362_0890317 3300039453 Bacteria 9610
117 Ga0451839_1503144 3300041496 Bacteria 1592
118 Ga0453684_0136457 3300044712 Bacteria 2936
119 Ga0466957_0183945 3300044842 Bacteria 1366
120 Ga0451576_0024810 3300045051 Bacteria 6470
121 Ga0495620_0007783 3300046515 Bacteria 5789
122 Ga0495686_0167901 3300047472 Bacteria 1278
123 Ga0496106_0209284 3300048909 Bacteria 1553
124 Ga0496121_0000043 3300048924 Bacteria 341882
125 Ga0496126_0033027 3300048929 Bacteria 4871
126 Ga0501042_0078545 3300049578 Bacteria 2364
127 Ga0501073_0125861 3300049589 Bacteria 1776
128 Ga0501080_0001282 3300049742 Bacteria 20889
129 nmdc:mga07m45_133090_c1 3300050496 Unclassified 1439
130 nmdc:mga05p37_259169_c1 3300050507 Bacteria 2082
131 nmdc:mga09592_11322_c1 3300050508 Bacteria 7254
132 nmdc:mga0qj67_147187_c1 3300050509 Bacteria 1910
133 nmdc:mga06r32_42125_c1 3300050510 Bacteria 4340
134 nmdc:mga08y16_15_c1 3300050511 Bacteria 397324
135 nmdc:mga0n895_138626_c1 3300050512 Bacteria 2460
136 nmdc:mga0rr50_25799_c1 3300050513 Bacteria 4091
137 nmdc:mga0rr50_4046_c1 3300050513 Bacteria 8555
138 Ga0500645_029428 3300053730 Unclassified 1658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006353 Ga0075370_10056738 Ga0075370_100567382 334
2 3300021384 Ga0213876_10006689 Ga0213876_100066897 337
3 3300039437 Ga0436365_1505044 Ga0436365_1505044_4229_5290 337
4 3300009094 Ga0111539_10000017 Ga0111539_1000001713 341
5 3300027907 Ga0207428_10000010 Ga0207428_10000010353 341
6 3300050511 nmdc:mga08y16_15_c1 nmdc:mga08y16_15_c1_379496_380563 341
7 3300014326 Ga0157380_10016599 Ga0157380_100165994 350
8 3300026121 Ga0207683_10125502 Ga0207683_101255023 352
9 3300005340 Ga0070689_100026999 Ga0070689_1000269994 353
10 3300005842 Ga0068858_100000173 Ga0068858_1000001733 353
11 3300009098 Ga0105245_10001765 Ga0105245_1000176514 353
12 3300013297 Ga0157378_10000013 Ga0157378_1000001315 353
13 3300025936 Ga0207670_10006179 Ga0207670_100061792 353
14 3300026035 Ga0207703_10000211 Ga0207703_1000021114 353
15 3300030521 Ga0307511_10001815 Ga0307511_1000181521 353
16 3300031665 Ga0316575_10000546 Ga0316575_100005463 353
17 3300031691 Ga0316579_10014824 Ga0316579_100148242 353
18 3300031691 Ga0316579_10071694 Ga0316579_100716942 353
19 3300031728 Ga0316578_10061445 Ga0316578_100614453 353
20 3300031728 Ga0316578_10076001 Ga0316578_100760011 353
21 3300031733 Ga0316577_10013531 Ga0316577_100135311 353
22 3300031733 Ga0316577_10069256 Ga0316577_100692562 353
23 3300032133 Ga0316583_10010978 Ga0316583_100109782 353
24 3300032137 Ga0316585_10004679 Ga0316585_100046793 353
25 3300035398 Ga0316574_0000441 Ga0316574_0000441_840_1901 353
26 3300036647 Ga0316582_0000857 Ga0316582_0000857_10598_11659 353
27 3300036712 Ga0316584_0005844 Ga0316584_0005844_6323_7384 353
28 3300036712 Ga0316584_0051617 Ga0316584_0051617_1674_2735 353
29 3300048909 Ga0496106_0209284 Ga0496106_0209284_50_1114 353
30 3300005327 Ga0070658_10039387 Ga0070658_100393872 354
31 3300005329 Ga0070683_100000050 Ga0070683_10000005057 354
32 3300005331 Ga0070670_100000184 Ga0070670_10000018434 354
33 3300005334 Ga0068869_100010382 Ga0068869_1000103822 354
34 3300005337 Ga0070682_100000002 Ga0070682_100000002441 354
35 3300005338 Ga0068868_100000068 Ga0068868_10000006828 354
36 3300005345 Ga0070692_10010286 Ga0070692_100102864 354
37 3300005535 Ga0070684_100000078 Ga0070684_10000007820 354
38 3300005539 Ga0068853_100047040 Ga0068853_1000470402 354
39 3300005543 Ga0070672_100004782 Ga0070672_1000047828 354
40 3300005578 Ga0068854_100039109 Ga0068854_1000391092 354
41 3300005618 Ga0068864_100000166 Ga0068864_10000016615 354
42 3300005719 Ga0068861_100032910 Ga0068861_1000329101 354
43 3300006173 Ga0070716_100037604 Ga0070716_1000376042 354
44 3300007076 Ga0075435_100055518 Ga0075435_1000555182 354
45 3300009098 Ga0105245_10000003 Ga0105245_10000003282 354
46 3300009098 Ga0105245_10002524 Ga0105245_100025243 354
47 3300009551 Ga0105238_10000115 Ga0105238_1000011542 354
48 3300013105 Ga0157369_10000166 Ga0157369_1000016654 354
49 3300013296 Ga0157374_10000006 Ga0157374_10000006197 354
50 3300013297 Ga0157378_10000310 Ga0157378_1000031048 354
51 3300013308 Ga0157375_10000009 Ga0157375_10000009154 354
52 3300013308 Ga0157375_10001126 Ga0157375_100011267 354
53 3300014745 Ga0157377_10000003 Ga0157377_10000003380 354
54 3300014969 Ga0157376_10000009 Ga0157376_10000009158 354
55 3300025924 Ga0207694_10000001 Ga0207694_100000013195 354
56 3300025925 Ga0207650_10000070 Ga0207650_1000007059 354
57 3300025927 Ga0207687_10000002 Ga0207687_10000002279 354
58 3300025927 Ga0207687_10001109 Ga0207687_100011095 354
59 3300025940 Ga0207691_10000675 Ga0207691_1000067523 354
60 3300025942 Ga0207689_10003392 Ga0207689_100033923 354
61 3300025944 Ga0207661_10000013 Ga0207661_10000013145 354
62 3300025981 Ga0207640_10020842 Ga0207640_100208424 354
63 3300025981 Ga0207640_10021539 Ga0207640_100215392 354
64 3300026023 Ga0207677_10000077 Ga0207677_1000007761 354
65 3300026095 Ga0207676_10000136 Ga0207676_1000013614 354
66 3300039437 Ga0436365_0414850 Ga0436365_0414850_99326_100390 354
67 3300039453 Ga0436362_0890317 Ga0436362_0890317_1615_2679 354
68 3300041496 Ga0451839_1503144 Ga0451839_1503144_502_1566 354
69 3300049589 Ga0501073_0125861 Ga0501073_0125861_503_1567 354
70 3300049742 Ga0501080_0001282 Ga0501080_0001282_15232_16296 354
71 3300005354 Ga0070675_100000018 Ga0070675_100000018114 355
72 3300005441 Ga0070700_100000152 Ga0070700_1000001529 355
73 3300005467 Ga0070706_100017070 Ga0070706_1000170702 355
74 3300005467 Ga0070706_100116977 Ga0070706_1001169772 355
75 3300005468 Ga0070707_100037024 Ga0070707_1000370244 355
76 3300005471 Ga0070698_100055617 Ga0070698_1000556172 355
77 3300005471 Ga0070698_100187104 Ga0070698_1001871041 355
78 3300005518 Ga0070699_100017010 Ga0070699_1000170107 355
79 3300006844 Ga0075428_100009054 Ga0075428_1000090547 355
80 3300006871 Ga0075434_100130461 Ga0075434_1001304612 355
81 3300009147 Ga0114129_10515278 Ga0114129_105152782 355
82 3300009176 Ga0105242_10005868 Ga0105242_100058685 355
83 3300010375 Ga0105239_10026658 Ga0105239_100266587 355
84 3300025910 Ga0207684_10036698 Ga0207684_100366986 355
85 3300025922 Ga0207646_10146480 Ga0207646_101464802 355
86 3300025926 Ga0207659_10000025 Ga0207659_1000002517 355
87 3300025934 Ga0207686_10002033 Ga0207686_100020338 355
88 3300026075 Ga0207708_10000007 Ga0207708_1000000779 355
89 3300044842 Ga0466957_0183945 Ga0466957_0183945_263_1330 355
90 3300050512 nmdc:mga0n895_138626_c1 nmdc:mga0n895_138626_c1_697_1764 355
91 3300005338 Ga0068868_100003274 Ga0068868_1000032746 356
92 3300005343 Ga0070687_100041900 Ga0070687_1000419002 356
93 3300013308 Ga0157375_10000245 Ga0157375_1000024530 356
94 3300025918 Ga0207662_10046368 Ga0207662_100463684 356
95 3300026023 Ga0207677_10000006 Ga0207677_10000006254 356
96 3300046515 Ga0495620_0007783 Ga0495620_0007783_1357_2427 356
97 3300050496 nmdc:mga07m45_133090_c1 nmdc:mga07m45_133090_c1_232_1302 356
98 3300050507 nmdc:mga05p37_259169_c1 nmdc:mga05p37_259169_c1_453_1532 356
99 3300006846 Ga0075430_100026964 Ga0075430_1000269647 357
100 3300007076 Ga0075435_100033306 Ga0075435_1000333064 357
101 3300021358 Ga0213873_10000001 Ga0213873_100000011233 357
102 3300021384 Ga0213876_10000002 Ga0213876_10000002307 357
103 3300039437 Ga0436365_0862132 Ga0436365_0862132_11936_13009 357
104 3300039453 Ga0436362_0842419 Ga0436362_0842419_78862_79935 357
105 3300049578 Ga0501042_0078545 Ga0501042_0078545_1258_2331 357
106 3300050509 nmdc:mga0qj67_147187_c1 nmdc:mga0qj67_147187_c1_483_1556 357
107 3300050513 nmdc:mga0rr50_25799_c1 nmdc:mga0rr50_25799_c1_2477_3550 357
108 iso_pu_bacteria 2739367866 2740031443 357
109 iso_pu_bacteria 2842903701 2842908472 357
110 3300005340 Ga0070689_100284607 Ga0070689_1002846071 358
111 3300005547 Ga0070693_100042320 Ga0070693_1000423202 358
112 3300006028 Ga0070717_10000097 Ga0070717_1000009752 358
113 3300006195 Ga0075366_10061782 Ga0075366_100617823 358
114 3300006847 Ga0075431_100015220 Ga0075431_1000152202 358
115 3300025928 Ga0207700_10021622 Ga0207700_100216222 358
116 3300050510 nmdc:mga06r32_42125_c1 nmdc:mga06r32_42125_c1_1558_2769 358
117 3300053730 Ga0500645_029428 Ga0500645_029428_422_1531 358
118 iso_pu_bacteria 2818991442 2819577442 358
119 iso_pu_bacteria 2821136567 2821138933 358
120 iso_pu_bacteria 2904467357 2904472487 358
121 3300006914 Ga0075436_100003381 Ga0075436_1000033817 359
122 3300007076 Ga0075435_100000040 Ga0075435_10000004042 359
123 3300031344 Ga0265316_10130290 Ga0265316_101302902 359
124 3300050513 nmdc:mga0rr50_4046_c1 nmdc:mga0rr50_4046_c1_1767_2849 359
125 3300006880 Ga0075429_100031363 Ga0075429_1000313632 360
126 3300031727 Ga0316576_10261730 Ga0316576_102617301 360
127 3300044712 Ga0453684_0136457 Ga0453684_0136457_103_1185 360
128 3300045051 Ga0451576_0024810 Ga0451576_0024810_2134_3219 360
129 3300047472 Ga0495686_0167901 Ga0495686_0167901_164_1246 360
130 3300050508 nmdc:mga09592_11322_c1 nmdc:mga09592_11322_c1_3063_4157 360
131 3300005455 Ga0070663_100002978 Ga0070663_1000029788 361
132 3300009545 Ga0105237_10010241 Ga0105237_100102414 361
133 3300013102 Ga0157371_10002954 Ga0157371_1000295420 361
134 3300013105 Ga0157369_10016904 Ga0157369_1001690413 361
135 3300013307 Ga0157372_10000010 Ga0157372_1000001028 361
136 3300025914 Ga0207671_10000149 Ga0207671_1000014968 361
137 3300037312 Ga0395899_0000744 Ga0395899_0000744_14147_15247 361
138 3300003323 rootH1_10308059 rootH1_103080592 362
139 3300015265 Ga0182005_1000216 Ga0182005_100021612 362
140 3300025208 Ga0209436_102390 Ga0209436_1023905 362
141 3300025302 Ga0207426_1004164 Ga0207426_10041644 362
142 3300048924 Ga0496121_0000043 Ga0496121_0000043_114807_115895 362
143 3300048929 Ga0496126_0033027 Ga0496126_0033027_1331_2434 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

177

256

0.92

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

303

403

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9216 6 359
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9216 6 359
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.913 6 359
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9129 6 359
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.9128 6 359
ID Description Score Start End Superfamily
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9359 6 362 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9302 6 362 3.40.47.10
af_P0A6R0_1_317_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9066 6 359 3.40.47.10
1zowD02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.906 202 360 3.40.47.10
1zowB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9013 6 200 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A3D0DI31-F1-model_v4 3-oxoacyl-ACP synthase 0.9895 2 204 GO:0004315
GO:0006633
GO:0044550
AF-X1BZY9-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III N-terminal domain-containing protein 0.9883 1 284 GO:0004315
GO:0006633
GO:0044550
AF-A0A4U6D891-F1-model_v4 Ketoacyl-ACP synthase III 0.9877 1 362 GO:0004315
GO:0006633
GO:0044550
AF-A0A1M7L814-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase-3 0.9857 3 361 GO:0004315
GO:0006633
GO:0016020
GO:0044550
AF-A0A4U6D891-F1-model_v4 Ketoacyl-ACP synthase III 0.985 1 362 GO:0004315
GO:0006633
GO:0044550

Feature Viewer

pLDDT pTM Quality
91.16 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map