F187308

General Info

Members Datasets Scaffolds Average Seq Length
142 119 104 766

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2932431166|2932434027
Length 822
Sequence VPSPTQNPVGFPAGTVLGYPRIGRRRELKKAVEAFWAGKTSAEELEATARGLRLATVRRLVELGLGADDASVPGTFSYYDQVLDVAASLGAVPSRFASLVDDAGRLDLAGYFTVARGQGDDAPLEMTKWFDTNYHYLVPEIGPDTPIRFVDDRVVREFVEAKEAGVVTRPVVVGPVTFLALSKAADDAPAGYSPLDRLDDVVAAYADLLRALAATGAPWVQLDEPILVTDPANAEELTEAVERAYRALATDLRPVPNPGPLPTETSGSGEIPGSAEDVRPAILVAAPYGRLETSPGPDGRYHDFLAVLSDTDIEAIALDGVAADLPDGLPQGLGTKTLVLGVIDGHNVWRADLAAKLDLIEQYPTGAHLGAVAVGTSTSLLHVPHDVEDETFAEPGTASGTTLDPRLRDWLAFADQKVGEVATLARALTEGRDAVAEEIEASRAAVASRAEASGVVVPAVRERAAALTDADFARGDYAERAAAQQERLNLPPLPTTTIGSFPQTPEIRRARALWTKGELSDADYTTAMREEIARVVAIQEELGLDVLVHGEPERNDMVQYFAEHLDGFAVTANGWVQSYGSRCVRPPILWGDVTRPAPITVEWSAYTASLTEKPVKGMLTGPVTILAWSFVRDDQPLGDTANQVGLALRDEIADLEAAGVGIVQVDEPALRELLPLRRADQPAYLDWSVGSFRLATSGVAAATQIHTHLCYSEFGEVIGAIDGLDADVTSVEAARSRMEIVPELRDAGYSRGIGPGVYDIHSPRVPSTEEVTELLELAVKSIDPRVVWVNPDCGLKTRRYEETVPSLEHLVTAAKAVRATLG

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
4 2643221549 Agromyces sp. Root1464 Isolate Unclassified
5 2643221572 Leifsonia sp. Root60 Isolate Unclassified
6 2643221613 Oerskovia sp. Root22 Isolate Unclassified
7 2643221619 Agromyces sp. Root81 Isolate Unclassified
8 2643221649 Leifsonia sp. Root4 Isolate Unclassified
9 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
10 2643221721 Oerskovia sp. Root918 Isolate Unclassified
11 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
12 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
13 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
14 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
15 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
16 2808606372 Agromyces sp. 23-23 Isolate Unclassified
17 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
18 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
19 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
20 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
21 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
22 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
23 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
24 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
25 2919395869 Microbacterium resistens 2980 Isolate Unclassified
26 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
27 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
28 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
29 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
30 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
31 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
32 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
33 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
34 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
35 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
36 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
95 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
96 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
97 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
110 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
111 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
112 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
113 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
114 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
115 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
116 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
117 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
118 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
119 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.24
Metatranscriptomes 0
Isolates 26.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.86
Nodule 0
Rhizoplane 2.82
Rhizosphere 60.56
Stem 0
Stem Tuber 0
Unclassified 26.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011113 3300001979 Bacteria 3439
2 JGI25154J39366_1000828 3300002738 Bacteria 13428
3 Ga0070658_10001257 3300005327 Bacteria 21711
4 Ga0070659_100000614 3300005366 Bacteria 26134
5 Ga0068855_100025461 3300005563 Bacteria 7079
6 Ga0068857_100005168 3300005577 Bacteria 11098
7 Ga0068852_100016574 3300005616 Bacteria 5753
8 Ga0068851_10000124 3300005834 Bacteria 41585
9 Ga0068858_100000175 3300005842 Bacteria 68239
10 Ga0075364_10000389 3300006051 Bacteria 21835
11 Ga0105244_10002358 3300009036 Bacteria 14341
12 Ga0105244_10013547 3300009036 Bacteria 4759
13 Ga0105240_10004036 3300009093 Bacteria 22588
14 Ga0105245_10029361 3300009098 Bacteria 4857
15 Ga0105243_10036291 3300009148 Bacteria 3826
16 Ga0105241_10000211 3300009174 Bacteria 43844
17 Ga0105248_10003861 3300009177 Bacteria 16578
18 Ga0105248_10017185 3300009177 Bacteria 7971
19 Ga0105237_10007321 3300009545 Bacteria 12100
20 Ga0105237_10010051 3300009545 Bacteria 10092
21 Ga0105238_10001857 3300009551 Bacteria 21165
22 Ga0157371_10004092 3300013102 Bacteria 12890
23 Ga0157370_10053336 3300013104 Bacteria 3856
24 Ga0171462_1001 3300013250 Bacteria 1135406
25 Ga0157374_10051641 3300013296 Bacteria 3826
26 Ga0163162_10038422 3300013306 Bacteria 4777
27 Ga0209646_1000013 3300025246 Bacteria 565830
28 Ga0207656_10000001 3300025321 Bacteria 1323684
29 Ga0207656_10000003 3300025321 Bacteria 771644
30 Ga0207656_10000004 3300025321 Bacteria 632320
31 Ga0207655_1000865 3300025728 Bacteria 32198
32 Ga0207655_1004752 3300025728 Bacteria 9481
33 Ga0207705_10000001 3300025909 Bacteria 2061880
34 Ga0207654_10000003 3300025911 Bacteria 1030378
35 Ga0207695_10004452 3300025913 Bacteria 19090
36 Ga0207695_10006949 3300025913 Bacteria 14535
37 Ga0207671_10000001 3300025914 Bacteria 1318881
38 Ga0207657_10003296 3300025919 Bacteria 17257
39 Ga0207694_10000039 3300025924 Bacteria 186164
40 Ga0207687_10016757 3300025927 Bacteria 4816
41 Ga0207690_10014153 3300025932 Bacteria 4813
42 Ga0207709_10020211 3300025935 Bacteria 3753
43 Ga0207711_10002075 3300025941 Bacteria 18101
44 Ga0207667_10001963 3300025949 Bacteria 25773
45 Ga0207667_10009785 3300025949 Bacteria 11275
46 Ga0207667_10104277 3300025949 Bacteria 2925
47 Ga0207658_10028372 3300025986 Bacteria 3942
48 Ga0207703_10000131 3300026035 Bacteria 90186
49 Ga0207674_10017917 3300026116 Bacteria 7720
50 Ga0307405_10005793 3300031731 Bacteria 6009
51 Ga0307406_10000213 3300031901 Bacteria 34975
52 Ga0395899_0002551 3300037312 Bacteria 14751
53 Ga0395898_0002073 3300037466 Bacteria 24948
54 Ga0395901_0045304 3300038443 Bacteria 4564
55 Ga0395901_0065163 3300038443 Bacteria 3793
56 Ga0436365_0721647 3300039437 Bacteria 32349
57 Ga0466965_0000002 3300044683 Bacteria 297957
58 Ga0466970_0000017 3300044765 Bacteria 64907
59 Ga0466958_0034576 3300045836 Bacteria 3016
60 Ga0466967_0016164 3300045976 Bacteria 5875
61 Ga0495590_0000183 3300046457 Bacteria 36526
62 Ga0495650_0000702 3300046471 Bacteria 42949
63 Ga0495672_0019743 3300047320 Bacteria 4439
64 Ga0496105_0092924 3300048908 Bacteria 2491
65 Ga0496108_0014692 3300048911 Bacteria 6391
66 Ga0496109_0015748 3300048912 Bacteria 6599
67 Ga0496114_0032593 3300048917 Bacteria 4289
68 Ga0496118_0013519 3300048921 Bacteria 7712
69 Ga0496119_0001675 3300048922 Bacteria 25909
70 Ga0496119_0001906 3300048922 Bacteria 23895
71 Ga0496119_0050886 3300048922 Bacteria 2549
72 Ga0496120_0001180 3300048923 Bacteria 33237
73 Ga0496121_0000277 3300048924 Bacteria 107014
74 Ga0496121_0025632 3300048924 Bacteria 5589
75 Ga0496122_0000384 3300048925 Bacteria 94131
76 Ga0496122_0000515 3300048925 Bacteria 79995
77 Ga0496122_0002530 3300048925 Bacteria 25739
78 Ga0496122_0004022 3300048925 Bacteria 18709
79 Ga0496123_0000074 3300048926 Bacteria 196689
80 Ga0496124_0002354 3300048927 Bacteria 24950
81 Ga0496125_0000046 3300048928 Bacteria 295288
82 Ga0496125_0001105 3300048928 Bacteria 41473
83 Ga0496126_0003402 3300048929 Bacteria 20109
84 Ga0501034_0000699 3300049571 Bacteria 50906
85 Ga0501038_0002092 3300049574 Bacteria 18498
86 Ga0501038_0038066 3300049574 Bacteria 4213
87 Ga0501047_0055007 3300049581 Bacteria 3849
88 Ga0501070_0001815 3300049586 Bacteria 18803
89 Ga0501080_0000058 3300049742 Bacteria 72664
90 Ga0501083_0000055 3300049744 Bacteria 82183
91 Ga0501083_0015112 3300049744 Bacteria 5404
92 nmdc:mga0yw44_2258_c1 3300050492 Bacteria 8122
93 Ga0500643_000189 3300053087 Bacteria 58813
94 Ga0500651_0000647 3300053093 Bacteria 17374
95 Ga0500556_0000062 3300053104 Bacteria 110818
96 Ga0500559_0000589 3300053136 Bacteria 24757
97 Ga0500559_0001158 3300053136 Bacteria 15884
98 Ga0500559_0013513 3300053136 Bacteria 3456
99 Ga0500568_0000060 3300053139 Bacteria 107901
100 Ga0500568_0000151 3300053139 Bacteria 60575
101 Ga0500573_0000007 3300053140 Bacteria 272970
102 Ga0500616_0000071 3300053153 Bacteria 232527
103 Ga0500616_0001401 3300053153 Bacteria 23221
104 Ga0500620_000023 3300053155 Bacteria 31007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0034576 Ga0466958_0034576_366_2456 685
2 3300009148 Ga0105243_10036291 Ga0105243_100362912 699
3 3300025935 Ga0207709_10020211 Ga0207709_100202112 699
4 3300009036 Ga0105244_10002358 Ga0105244_100023583 700
5 3300025728 Ga0207655_1000865 Ga0207655_100086520 700
6 3300049581 Ga0501047_0055007 Ga0501047_0055007_384_2729 707
7 3300049586 Ga0501070_0001815 Ga0501070_0001815_13231_15561 707
8 3300048908 Ga0496105_0092924 Ga0496105_0092924_40_2391 718
9 3300048921 Ga0496118_0013519 Ga0496118_0013519_5322_7694 731
10 3300053139 Ga0500568_0000151 Ga0500568_0000151_25916_28222 735
11 3300048922 Ga0496119_0001906 Ga0496119_0001906_3439_5772 736
12 3300053155 Ga0500620_000023 Ga0500620_000023_5550_7883 739
13 3300053093 Ga0500651_0000647 Ga0500651_0000647_1679_3997 740
14 3300005563 Ga0068855_100025461 Ga0068855_1000254612 741
15 3300025949 Ga0207667_10009785 Ga0207667_100097853 741
16 3300046457 Ga0495590_0000183 Ga0495590_0000183_18231_20546 744
17 3300005577 Ga0068857_100005168 Ga0068857_1000051686 747
18 3300005616 Ga0068852_100016574 Ga0068852_1000165743 747
19 3300005834 Ga0068851_10000124 Ga0068851_1000012434 747
20 3300009545 Ga0105237_10010051 Ga0105237_100100518 747
21 3300009551 Ga0105238_10001857 Ga0105238_100018572 747
22 3300025321 Ga0207656_10000001 Ga0207656_1000000142 747
23 3300025321 Ga0207656_10000003 Ga0207656_10000003148 747
24 3300025321 Ga0207656_10000004 Ga0207656_100000045 747
25 3300025914 Ga0207671_10000001 Ga0207671_1000000140 747
26 3300025924 Ga0207694_10000039 Ga0207694_1000003928 747
27 3300026116 Ga0207674_10017917 Ga0207674_100179172 747
28 3300048925 Ga0496122_0004022 Ga0496122_0004022_1666_4002 747
29 iso_pu_bacteria 2551306166 2552109576 748
30 iso_pu_bacteria 2547132424 2548697913 749
31 iso_pu_bacteria 2919713450 2919715909 749
32 3300006051 Ga0075364_10000389 Ga0075364_100003896 753
33 3300039437 Ga0436365_0721647 Ga0436365_0721647_21640_23910 753
34 3300045976 Ga0466967_0016164 Ga0466967_0016164_81_2351 753
35 3300048929 Ga0496126_0003402 Ga0496126_0003402_6643_8922 753
36 iso_pu_bacteria 2775506925 2776370133 753
37 iso_pu_bacteria 2863067949 2863074013 753
38 3300048924 Ga0496121_0025632 Ga0496121_0025632_3195_5510 757
39 3300037312 Ga0395899_0002551 Ga0395899_0002551_1998_4328 761
40 3300037466 Ga0395898_0002073 Ga0395898_0002073_19443_21773 761
41 3300038443 Ga0395901_0045304 Ga0395901_0045304_1022_3340 761
42 3300044765 Ga0466970_0000017 Ga0466970_0000017_30733_33054 762
43 3300031731 Ga0307405_10005793 Ga0307405_100057932 763
44 3300038443 Ga0395901_0065163 Ga0395901_0065163_437_2770 763
45 3300048911 Ga0496108_0014692 Ga0496108_0014692_1536_3872 763
46 3300048912 Ga0496109_0015748 Ga0496109_0015748_2186_4522 763
47 3300050492 nmdc:mga0yw44_2258_c1 nmdc:mga0yw44_2258_c1_4662_6998 763
48 3300053140 Ga0500573_0000007 Ga0500573_0000007_237130_239490 764
49 3300009177 Ga0105248_10003861 Ga0105248_100038618 766
50 3300009545 Ga0105237_10007321 Ga0105237_100073213 766
51 3300013296 Ga0157374_10051641 Ga0157374_100516411 766
52 3300025941 Ga0207711_10002075 Ga0207711_100020759 766
53 3300044683 Ga0466965_0000002 Ga0466965_0000002_37649_39955 766
54 3300048924 Ga0496121_0000277 Ga0496121_0000277_73297_75624 766
55 3300049574 Ga0501038_0038066 Ga0501038_0038066_1697_4003 766
56 3300053136 Ga0500559_0001158 Ga0500559_0001158_12712_15030 766
57 iso_pu_bacteria 2643221721 2644664905 766
58 iso_pu_bacteria 2935890801 2935894511 766
59 iso_pu_bacteria 2946033335 2946036978 766
60 iso_pu_bacteria 2946041624 2946044777 766
61 iso_pu_bacteria 8004182704 8004185666 766
62 3300005366 Ga0070659_100000614 Ga0070659_1000006146 767
63 3300005842 Ga0068858_100000175 Ga0068858_10000017532 767
64 3300009098 Ga0105245_10029361 Ga0105245_100293613 767
65 3300009177 Ga0105248_10017185 Ga0105248_100171854 767
66 3300013104 Ga0157370_10053336 Ga0157370_100533362 767
67 3300025913 Ga0207695_10004452 Ga0207695_100044526 767
68 3300025919 Ga0207657_10003296 Ga0207657_100032969 767
69 3300025927 Ga0207687_10016757 Ga0207687_100167573 767
70 3300025932 Ga0207690_10014153 Ga0207690_100141532 767
71 3300025949 Ga0207667_10001963 Ga0207667_1000196320 767
72 3300025949 Ga0207667_10104277 Ga0207667_101042771 767
73 3300025986 Ga0207658_10028372 Ga0207658_100283722 767
74 3300026035 Ga0207703_10000131 Ga0207703_1000013139 767
75 3300048925 Ga0496122_0000515 Ga0496122_0000515_58210_60561 767
76 3300048925 Ga0496122_0002530 Ga0496122_0002530_9891_12197 767
77 3300049742 Ga0501080_0000058 Ga0501080_0000058_14685_17012 767
78 3300049744 Ga0501083_0015112 Ga0501083_0015112_2042_4369 767
79 3300053153 Ga0500616_0000071 Ga0500616_0000071_29849_32179 767
80 iso_pu_bacteria 2808606368 2808885251 767
81 iso_pu_bacteria 2857733635 2857735427 767
82 iso_pu_bacteria 2919395869 2919395898 767
83 iso_pu_bacteria 2939657138 2939657601 767
84 3300005327 Ga0070658_10001257 Ga0070658_1000125711 768
85 3300009093 Ga0105240_10004036 Ga0105240_1000403611 768
86 3300009174 Ga0105241_10000211 Ga0105241_1000021133 768
87 3300025909 Ga0207705_10000001 Ga0207705_100000012020 768
88 3300025911 Ga0207654_10000003 Ga0207654_10000003346 768
89 3300025913 Ga0207695_10006949 Ga0207695_1000694910 768
90 3300046471 Ga0495650_0000702 Ga0495650_0000702_34222_36555 768
91 3300047320 Ga0495672_0019743 Ga0495672_0019743_710_3031 768
92 3300048922 Ga0496119_0001675 Ga0496119_0001675_15067_17385 768
93 3300048923 Ga0496120_0001180 Ga0496120_0001180_11496_13814 768
94 3300053087 Ga0500643_000189 Ga0500643_000189_48806_51115 768
95 3300053104 Ga0500556_0000062 Ga0500556_0000062_78216_80528 768
96 3300053139 Ga0500568_0000060 Ga0500568_0000060_79184_81496 768
97 3300053153 Ga0500616_0001401 Ga0500616_0001401_8573_10906 768
98 iso_pu_bacteria 2643221613 2644084274 768
99 iso_pu_bacteria 2852643534 2852645222 768
100 iso_pu_bacteria 2932431166 2932434027 768
101 iso_pu_bacteria 2977251589 2977253583 768
102 3300002738 JGI25154J39366_1000828 JGI25154J39366_10008283 769
103 3300025246 Ga0209646_1000013 Ga0209646_1000013537 769
104 3300048928 Ga0496125_0000046 Ga0496125_0000046_153895_156246 769
105 3300053136 Ga0500559_0000589 Ga0500559_0000589_15889_18204 769
106 3300053136 Ga0500559_0013513 Ga0500559_0013513_806_3121 769
107 iso_pu_bacteria 2585428094 2587864523 769
108 iso_pu_bacteria 2643221572 2643877899 769
109 iso_pu_bacteria 2643221669 2644384954 769
110 iso_pu_bacteria 2721755702 2723642613 769
111 iso_pu_bacteria 2728369276 2729908464 769
112 iso_pu_bacteria 2808606372 2808902584 769
113 iso_pu_bacteria 2811994880 2812363084 769
114 iso_pu_bacteria 2895660088 2895662770 769
115 iso_pu_bacteria 2919443155 2919443191 769
116 iso_pu_bacteria 2935409751 2935413225 769
117 iso_pu_bacteria 2964326757 2964328672 769
118 iso_pu_bacteria 2966921586 2966923903 769
119 iso_pu_bacteria 8046352972 8046356054 769
120 3300009036 Ga0105244_10013547 Ga0105244_100135472 770
121 3300013102 Ga0157371_10004092 Ga0157371_100040923 770
122 3300025728 Ga0207655_1004752 Ga0207655_10047522 770
123 3300049571 Ga0501034_0000699 Ga0501034_0000699_33170_35482 770
124 3300049574 Ga0501038_0002092 Ga0501038_0002092_724_3036 770
125 3300013250 Ga0171462_1001 Ga0171462_100139 771
126 3300031901 Ga0307406_10000213 Ga0307406_1000021347 771
127 3300048922 Ga0496119_0050886 Ga0496119_0050886_15_2345 771
128 iso_pu_bacteria 2643221549 2643769321 771
129 iso_pu_bacteria 2643221619 2644113938 771
130 iso_pu_bacteria 2643221649 2644280495 771
131 iso_pu_bacteria 2839986021 2839988046 771
132 3300048925 Ga0496122_0000384 Ga0496122_0000384_61293_63638 772
133 3300048926 Ga0496123_0000074 Ga0496123_0000074_95346_97691 772
134 3300048927 Ga0496124_0002354 Ga0496124_0002354_5336_7681 772
135 3300049744 Ga0501083_0000055 Ga0501083_0000055_27476_29815 772
136 3300001979 JGI24740J21852_10011113 JGI24740J21852_100111132 773
137 3300013306 Ga0163162_10038422 Ga0163162_100384222 773
138 3300048917 Ga0496114_0032593 Ga0496114_0032593_1853_4177 773
139 3300048928 Ga0496125_0001105 Ga0496125_0001105_37734_40082 773
140 iso_pu_bacteria 2773857763 2774399983 773
141 iso_pu_bacteria 2811994872 2812322647 773
142 iso_pu_bacteria 2821268502 2821269569 773

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

493

816

1

PF08267

Meth_synt_1

Cobalamin-independent synthase, N-terminal domain

13

255

0.93

PF08267

Meth_synt_1

Cobalamin-independent synthase, N-terminal domain

298

367

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qqu-assembly1.cif.gz_A crystal structure of the cobalamin-independent methionine synthase enzyme in a closed conformation 0.9266 4 768
4qqu-assembly1.cif.gz_A crystal structure of the cobalamin-independent methionine synthase enzyme in a closed conformation 0.9243 4 768
4l5z-assembly1.cif.gz_A crystal structure of the candida albicans methionine synthase in complex with homocysteine 0.9029 4 768
4l65-assembly1.cif.gz_A crystal structure of the candida albicans methionine synthase in complex with 5-methyl-tetrahydrofolate and methionine 0.9009 4 767
1t7l-assembly2.cif.gz_B crystal structure of cobalamin-independent methionine synthase from t. maritima 0.9006 4 767
ID Description Score Start End Superfamily
af_Q54X49_428_818_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9721 382 765 3.20.20.210
af_P9WK07_10_390_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.964 6 398 3.20.20.210
af_P9WK07_10_390_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9566 6 398 3.20.20.210
af_P9WK07_11_319_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9552 8 327 3.20.20.210
af_Q54X49_428_818_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9527 382 765 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A3C1KGF1-F1-model_v4 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase 0.991 1 216 GO:0003871
GO:0008270
GO:0008652
GO:0032259
AF-A0A4Q2JHA2-F1-model_v4 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase 0.9904 2 396 GO:0003871
GO:0008270
GO:0008652
GO:0032259
AF-U2R1K8-F1-model_v4 Cobalamin-independent synthase protein 0.9904 47 240 GO:0003871
GO:0008270
GO:0008652
AF-A0A7X7QD53-F1-model_v4 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase (EC 2.1.1.14) 0.9832 3 545 GO:0003871
GO:0008270
GO:0009086
GO:0032259
AF-A0A6G3XYD4-F1-model_v4 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase 0.9816 548 656 GO:0003871
GO:0008270
GO:0009086
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.43 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map