F187065

General Info

Members Datasets Scaffolds Average Seq Length
142 100 284 283

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_115816_c1|nmdc:mga09592_115816_c1_579_1520
Length 313
Sequence VVPFKRGRAAVLAGVVWAAVSFRLPHYARFITPPRQTMLDLYDKVQEAADKIRARFGPAPHAGIILGTGLKNFAEHIEIQSAIDYEEIPHFPRATATGHGNRLVCGAIGGLPVVAMEGRFHMYEGYPLKQITLPVRVMKALGASLLVITNACGGMNPYYRCGDIMVIDDHINLLGDNPLIGINDDRLGPRFPDMCQPYDRDLIERALEIARRENFAAHQGVFVAVAGPNLETRAEYRFLRQIGADVVGMSTVPEVLVAVHCGLKVLGLSVVTDMCLPDALEPADVPKIIATANAAEPKLRKLILGVLAGEKTT

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
45 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
46 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
53 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
54 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
55 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
62 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
63 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
92 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
93 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
96 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
97 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
98 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
99 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
100 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 2.11
Isolates 3.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 0.7
Rhizosphere 91.55
Stem 0
Stem Tuber 0
Unclassified 6.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_115816_c1 3300050508 Bacteria 2300
2 Ga0065712_10072103 3300005290 Bacteria 4904
3 Ga0070689_100061090 3300005340 Bacteria 2931
4 Ga0070661_100007493 3300005344 Bacteria 7529
5 Ga0070709_10508603 3300005434 Bacteria 916
6 Ga0070714_100016210 3300005435 Bacteria 6011
7 Ga0070681_10009056 3300005458 Bacteria 9785
8 Ga0070681_10285341 3300005458 Bacteria 1561
9 Ga0070699_100086270 3300005518 Bacteria 2739
10 Ga0070679_100052188 3300005530 Bacteria 4074
11 Ga0070684_100084647 3300005535 Bacteria 2811
12 Ga0070696_100003663 3300005546 Bacteria 10249
13 Ga0070665_100000644 3300005548 Bacteria 47308
14 Ga0068855_100294509 3300005563 Bacteria 1798
15 Ga0068855_100328621 3300005563 Bacteria 1688
16 Ga0068854_100027555 3300005578 Bacteria 3917
17 Ga0068852_100182914 3300005616 Bacteria 1972
18 Ga0075370_10187490 3300006353 Bacteria 1218
19 Ga0075428_100001256 3300006844 Bacteria 27079
20 Ga0075429_100126158 3300006880 Bacteria 2238
21 Ga0075436_100007164 3300006914 Bacteria 7630
22 Ga0105240_10004437 3300009093 Bacteria 21401
23 Ga0105240_10135428 3300009093 Bacteria 2950
24 Ga0105240_10220749 3300009093 Bacteria 2209
25 Ga0105241_10012411 3300009174 Bacteria 6245
26 Ga0157373_10000674 3300013100 Bacteria 26717
27 Ga0157370_10082924 3300013104 Bacteria 3015
28 Ga0157369_10098664 3300013105 Bacteria 3114
29 Ga0157372_10007933 3300013307 Bacteria 11284
30 Ga0157372_10211612 3300013307 Bacteria 2247
31 Ga0157379_10493907 3300014968 Bacteria 1134
32 Ga0206354_11705759 3300020081 Bacteria 2421
33 Ga0207707_10011932 3300025912 Bacteria 7559
34 Ga0207707_10057836 3300025912 Bacteria 3374
35 Ga0207695_10003486 3300025913 Bacteria 22123
36 Ga0207695_10037157 3300025913 Bacteria 5256
37 Ga0207695_10061730 3300025913 Bacteria 3873
38 Ga0207660_10000760 3300025917 Bacteria 21451
39 Ga0207657_10089016 3300025919 Bacteria 2579
40 Ga0207649_10005599 3300025920 Bacteria 6792
41 Ga0207649_10047180 3300025920 Bacteria 2650
42 Ga0207652_10000783 3300025921 Bacteria 30376
43 Ga0207652_10013892 3300025921 Bacteria 6517
44 Ga0207652_10081101 3300025921 Bacteria 2838
45 Ga0207694_10057430 3300025924 Bacteria 3025
46 Ga0207687_10237954 3300025927 Bacteria 1441
47 Ga0207664_10061908 3300025929 Bacteria 2987
48 Ga0207670_10154549 3300025936 Unclassified 1706
49 Ga0207661_10029455 3300025944 Bacteria 4216
50 Ga0207667_10066322 3300025949 Bacteria 3763
51 Ga0207640_10002551 3300025981 Bacteria 9762
52 Ga0207639_10075337 3300026041 Bacteria 2653
53 Ga0207698_10637411 3300026142 Bacteria 1054
54 Ga0268266_10007282 3300028379 Bacteria 10005
55 Ga0265323_10000021 3300028653 Bacteria 87631
56 Ga0265330_10012517 3300031235 Bacteria 3968
57 Ga0265330_10085759 3300031235 Bacteria 1354
58 Ga0265325_10035574 3300031241 Bacteria 2644
59 Ga0265316_10000551 3300031344 Bacteria 42160
60 Ga0265316_10005644 3300031344 Bacteria 12113
61 Ga0265316_10007750 3300031344 Bacteria 10059
62 Ga0316579_10046481 3300031691 Bacteria 2025
63 Ga0316579_10061584 3300031691 Bacteria 1767
64 Ga0316576_10167230 3300031727 Bacteria 1659
65 Ga0316578_10009339 3300031728 Bacteria 5041
66 Ga0316578_10038600 3300031728 Bacteria 2754
67 Ga0316578_10095015 3300031728 Bacteria 1783
68 Ga0316577_10026619 3300031733 Bacteria 3221
69 Ga0316577_10055094 3300031733 Bacteria 2219
70 Ga0316577_10063755 3300031733 Bacteria 2057
71 Ga0316577_10071369 3300031733 Bacteria 1938
72 Ga0316577_10156887 3300031733 Unclassified 1283
73 Ga0316577_10173799 3300031733 Unclassified 1216
74 Ga0316583_10051451 3300032133 Unclassified 1449
75 Ga0316585_10006352 3300032137 Bacteria 3378
76 Ga0316585_10043059 3300032137 Bacteria 1440
77 Ga0316580_10008431 3300032139 Bacteria 3086
78 Ga0316592_1023846 3300033524 Bacteria 1315
79 Ga0316596_1010411 3300033541 Bacteria 2249
80 Ga0316574_0028856 3300035398 Bacteria 3348
81 Ga0316574_0092582 3300035398 Bacteria 1929
82 Ga0316574_0245786 3300035398 Bacteria 1143
83 Ga0316582_0016136 3300036647 Bacteria 4289
84 Ga0316582_0028691 3300036647 Bacteria 3373
85 Ga0316582_0117505 3300036647 Unclassified 1777
86 Ga0316584_0019000 3300036712 Bacteria 4965
87 Ga0316584_0033631 3300036712 Bacteria 3798
88 Ga0316584_0036873 3300036712 Bacteria 3629
89 Ga0316584_0239079 3300036712 Bacteria 1329
90 Ga0373925_0022307 3300037068 Bacteria 4618
91 Ga0400490_08330 3300038726 Unclassified 3434
92 Ga0400483_084824 3300039062 Bacteria 2047
93 Ga0400489_02834 3300039093 Bacteria 1749
94 Ga0400489_79100 3300039093 Bacteria 45356
95 Ga0436365_1922585 3300039437 Bacteria 933
96 Ga0453684_0006349 3300044712 Bacteria 22539
97 Ga0453684_0101733 3300044712 Unclassified 3515
98 Ga0453684_0229495 3300044712 Bacteria 2144
99 Ga0451576_0092557 3300045051 Bacteria 3145
100 Ga0495629_0221259 3300046459 Bacteria 1306
101 Ga0495580_0199751 3300046472 Bacteria 1378
102 Ga0495608_0054275 3300046511 Bacteria 2649
103 Ga0495618_0063480 3300046514 Bacteria 2345
104 Ga0495666_0167833 3300046526 Bacteria 1016
105 Ga0495652_0058665 3300046529 Bacteria 3258
106 Ga0495640_0149226 3300046533 Bacteria 1503
107 Ga0495645_0046579 3300046543 Bacteria 3160
108 Ga0495667_0014601 3300046559 Bacteria 5306
109 Ga0495635_0089684 3300046663 Bacteria 2104
110 Ga0495624_0085710 3300046690 Bacteria 1946
111 Ga0495581_0070707 3300047315 Bacteria 2019
112 Ga0495604_0302285 3300047317 Unclassified 1074
113 Ga0495674_0028575 3300047319 Bacteria 5082
114 Ga0495680_0017702 3300047322 Bacteria 6070
115 Ga0495684_0001848 3300047471 Bacteria 16999
116 Ga0496104_0326255 3300048907 Bacteria 1448
117 Ga0501034_0002638 3300049571 Bacteria 21258
118 Ga0501034_0002690 3300049571 Bacteria 20935
119 Ga0501034_0006699 3300049571 Bacteria 12352
120 Ga0501034_0043040 3300049571 Bacteria 4571
121 Ga0501034_0088674 3300049571 Bacteria 3091
122 Ga0501034_0156317 3300049571 Bacteria 2254
123 Ga0501034_0279554 3300049571 Bacteria 1609
124 Ga0501043_0015307 3300049579 Bacteria 6008
125 Ga0501047_0008820 3300049581 Bacteria 9517
126 Ga0501047_0299470 3300049581 Bacteria 1451
127 Ga0501070_0000590 3300049586 Bacteria 33127
128 Ga0501076_0076123 3300049592 Bacteria 2691
129 Ga0501076_0489837 3300049592 Bacteria 1013
130 Ga0501035_0132623 3300049822 Bacteria 2171
131 Ga0501044_0163389 3300049823 Bacteria 2202
132 Ga0501044_0270548 3300049823 Bacteria 1635
133 nmdc:mga03n38_61119_c1 3300050490 Bacteria 1715
134 nmdc:mga07m45_156925_c2 3300050496 Bacteria 947
135 nmdc:mga08x19_41547_c1 3300050514 Bacteria 2929
136 Ga0501082_0301663 3300060353 Unclassified 1395
137 Ga0530510_0441787 3300061734 Bacteria 983
138 2687234283 2684623219 Bacteria 8442773
139 2688066233 2687453257 Bacteria 6784659
140 2688393448 2687453341 Bacteria 6534136
141 2889419833 2889415604 Bacteria 8048700
142 2920111291 2920107658 Bacteria 10042636
143 nmdc:mga09592_115816_c1
144 Ga0065712_10072103
145 Ga0070689_100061090
146 Ga0070661_100007493
147 Ga0070709_10508603
148 Ga0070714_100016210
149 Ga0070681_10009056
150 Ga0070681_10285341
151 Ga0070699_100086270
152 Ga0070679_100052188
153 Ga0070684_100084647
154 Ga0070696_100003663
155 Ga0070665_100000644
156 Ga0068855_100294509
157 Ga0068855_100328621
158 Ga0068854_100027555
159 Ga0068852_100182914
160 Ga0075370_10187490
161 Ga0075428_100001256
162 Ga0075429_100126158
163 Ga0075436_100007164
164 Ga0105240_10004437
165 Ga0105240_10135428
166 Ga0105240_10220749
167 Ga0105241_10012411
168 Ga0157373_10000674
169 Ga0157370_10082924
170 Ga0157369_10098664
171 Ga0157372_10007933
172 Ga0157372_10211612
173 Ga0157379_10493907
174 Ga0206354_11705759
175 Ga0207707_10011932
176 Ga0207707_10057836
177 Ga0207695_10003486
178 Ga0207695_10037157
179 Ga0207695_10061730
180 Ga0207660_10000760
181 Ga0207657_10089016
182 Ga0207649_10005599
183 Ga0207649_10047180
184 Ga0207652_10000783
185 Ga0207652_10013892
186 Ga0207652_10081101
187 Ga0207694_10057430
188 Ga0207687_10237954
189 Ga0207664_10061908
190 Ga0207670_10154549
191 Ga0207661_10029455
192 Ga0207667_10066322
193 Ga0207640_10002551
194 Ga0207639_10075337
195 Ga0207698_10637411
196 Ga0268266_10007282
197 Ga0265323_10000021
198 Ga0265330_10012517
199 Ga0265330_10085759
200 Ga0265325_10035574
201 Ga0265316_10000551
202 Ga0265316_10005644
203 Ga0265316_10007750
204 Ga0316579_10046481
205 Ga0316579_10061584
206 Ga0316576_10167230
207 Ga0316578_10009339
208 Ga0316578_10038600
209 Ga0316578_10095015
210 Ga0316577_10026619
211 Ga0316577_10055094
212 Ga0316577_10063755
213 Ga0316577_10071369
214 Ga0316577_10156887
215 Ga0316577_10173799
216 Ga0316583_10051451
217 Ga0316585_10006352
218 Ga0316585_10043059
219 Ga0316580_10008431
220 Ga0316592_1023846
221 Ga0316596_1010411
222 Ga0316574_0028856
223 Ga0316574_0092582
224 Ga0316574_0245786
225 Ga0316582_0016136
226 Ga0316582_0028691
227 Ga0316582_0117505
228 Ga0316584_0019000
229 Ga0316584_0033631
230 Ga0316584_0036873
231 Ga0316584_0239079
232 Ga0373925_0022307
233 Ga0400490_08330
234 Ga0400483_084824
235 Ga0400489_02834
236 Ga0400489_79100
237 Ga0436365_1922585
238 Ga0453684_0006349
239 Ga0453684_0101733
240 Ga0453684_0229495
241 Ga0451576_0092557
242 Ga0495629_0221259
243 Ga0495580_0199751
244 Ga0495608_0054275
245 Ga0495618_0063480
246 Ga0495666_0167833
247 Ga0495652_0058665
248 Ga0495640_0149226
249 Ga0495645_0046579
250 Ga0495667_0014601
251 Ga0495635_0089684
252 Ga0495624_0085710
253 Ga0495581_0070707
254 Ga0495604_0302285
255 Ga0495674_0028575
256 Ga0495680_0017702
257 Ga0495684_0001848
258 Ga0496104_0326255
259 Ga0501034_0002638
260 Ga0501034_0002690
261 Ga0501034_0006699
262 Ga0501034_0043040
263 Ga0501034_0088674
264 Ga0501034_0156317
265 Ga0501034_0279554
266 Ga0501043_0015307
267 Ga0501047_0008820
268 Ga0501047_0299470
269 Ga0501070_0000590
270 Ga0501076_0076123
271 Ga0501076_0489837
272 Ga0501035_0132623
273 Ga0501044_0163389
274 Ga0501044_0270548
275 nmdc:mga03n38_61119_c1
276 nmdc:mga07m45_156925_c2
277 nmdc:mga08x19_41547_c1
278 Ga0501082_0301663
279 Ga0530510_0441787
280 2687234283
281 2688066233
282 2688393448
283 2889419833
284 2920111291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

61

308

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m1e-assembly1.cif.gz_B crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364. 0.9911 4 270
6tk9-assembly1.cif.gz_B purine-nucleoside phosphorylase from thermus thermophilus 0.9842 3 272
8swt-assembly1.cif.gz_A structure of bacteroides fragilis pnp bound to transition state analog immucillin h and sulfate 0.9816 4 270
6tk9-assembly1.cif.gz_B purine-nucleoside phosphorylase from thermus thermophilus 0.977 3 272
8swu-assembly1.cif.gz_A structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate 0.9742 4 272
ID Description Score Start End Superfamily
af_U4PSA1_35_317_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9663 5 271 3.40.50.1580
4lnaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9615 5 267 3.40.50.1580
1yqqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9598 7 276 3.40.50.1580
af_Q9W1K6_46_314_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9593 5 237 3.40.50.1580
1vmkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9548 5 270 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A812QJ54-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9983 85 270 GO:0004731
GO:0005737
GO:0009116
AF-A0A257U833-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9955 4 121 GO:0004731
GO:0005737
GO:0009116
AF-A0A517XS26-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.995 4 272 GO:0004731
GO:0005737
GO:0009116
AF-A0A2V7G2S7-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.994 8 271 GO:0004731
GO:0005737
GO:0009116
AF-A0A6N8VSK3-F1-model_v4 deleted 0.9928 4 272

Map