F186797

General Info

Members Datasets Scaffolds Average Seq Length
142 85 142 300

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0002036|Ga0495686_0002036_15734_16714
Length 326
Sequence MSPAVSEAIPVSDEVSGSGASMTVGVVMAERLYAGLIVDHKLVGALKSLPPASTKLDADEDNSMVEMPSDEVFDSICKLVVDVAKGHETDIVAVGVAVPGLVRNGVVEEAPNLPQLKGARIEAKLIELLAAHGVSTTVNVMNDADAVAAGLASQHDKLDHFLRVWTLGTGIGYGQYPFSEGVWENGHMVVTLDDKERFCGCGGRGHLEGIMGHRAMRLRFLDMEPEEVFALANRHSDADTRCLEFKKLWHRALAAATASSIHSRGAGRFYLTGYNVRFLDLNMLKDYLHQMVKMSPLQSYILEVVEDHHETRVLGAAVAAEQAVSR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
35 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
61 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
62 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
63 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
69 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
70 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
71 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
72 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 0.7
Rhizosphere 85.21
Stem 0
Stem Tuber 0
Unclassified 13.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10088974 3300005290 Bacteria 2493
2 Ga0070658_10000142 3300005327 Bacteria 63262
3 Ga0070658_10007501 3300005327 Bacteria 8802
4 Ga0070658_10007579 3300005327 Bacteria 8757
5 Ga0070658_10012355 3300005327 Bacteria 6856
6 Ga0070658_10021779 3300005327 Bacteria 5137
7 Ga0070658_10094645 3300005327 Unclassified 2465
8 Ga0070658_10123655 3300005327 Bacteria 2151
9 Ga0070658_10212043 3300005327 Bacteria 1636
10 Ga0070683_100038109 3300005329 Bacteria 4404
11 Ga0070683_100046105 3300005329 Bacteria 4026
12 Ga0070680_100087037 3300005336 Bacteria 2583
13 Ga0070660_100159313 3300005339 Bacteria 1818
14 Ga0070673_100046051 3300005364 Bacteria 3386
15 Ga0070667_100305938 3300005367 Bacteria 1432
16 Ga0070714_100205291 3300005435 Bacteria 1804
17 Ga0070714_100378459 3300005435 Bacteria 1334
18 Ga0070714_100451075 3300005435 Unclassified 1222
19 Ga0070663_100098969 3300005455 Unclassified 2173
20 Ga0070663_100113196 3300005455 Bacteria 2042
21 Ga0070679_100000399 3300005530 Bacteria 36947
22 Ga0070679_100007882 3300005530 Bacteria 9989
23 Ga0070679_100135438 3300005530 Bacteria 2444
24 Ga0068853_100012665 3300005539 Bacteria 6868
25 Ga0070695_100089525 3300005545 Unclassified 2052
26 Ga0070665_100057735 3300005548 Bacteria 3891
27 Ga0070704_100087627 3300005549 Bacteria 2311
28 Ga0068855_100010188 3300005563 Bacteria 11330
29 Ga0068855_100040587 3300005563 Bacteria 5523
30 Ga0068856_100013033 3300005614 Bacteria 8051
31 Ga0068852_100011913 3300005616 Bacteria 6576
32 Ga0068859_100281005 3300005617 Bacteria 1757
33 Ga0068862_100027579 3300005844 Bacteria 4781
34 Ga0070717_10199476 3300006028 Bacteria 1752
35 Ga0097620_100280995 3300006931 Bacteria 1757
36 Ga0105240_10000001 3300009093 Bacteria 2887840
37 Ga0105240_10000498 3300009093 Bacteria 72329
38 Ga0105240_10279347 3300009093 Bacteria 1919
39 Ga0105241_10612063 3300009174 Bacteria 985
40 Ga0105248_10435355 3300009177 Bacteria 1477
41 Ga0105238_10003188 3300009551 Bacteria 16365
42 Ga0105238_10097742 3300009551 Bacteria 2921
43 Ga0105238_10313414 3300009551 Bacteria 1554
44 Ga0105249_10034371 3300009553 Bacteria 4594
45 Ga0105249_10129415 3300009553 Bacteria 2408
46 Ga0105239_10213062 3300010375 Bacteria 2166
47 Ga0157370_10044647 3300013104 Bacteria 4257
48 Ga0157369_10015791 3300013105 Bacteria 8507
49 Ga0157369_10055943 3300013105 Bacteria 4258
50 Ga0157369_10083561 3300013105 Bacteria 3415
51 Ga0157369_10139414 3300013105 Bacteria 2567
52 Ga0157369_10141254 3300013105 Bacteria 2548
53 Ga0157369_10156923 3300013105 Bacteria 2403
54 Ga0157369_10265636 3300013105 Bacteria 1789
55 Ga0157374_10036568 3300013296 Bacteria 4499
56 Ga0157372_10005374 3300013307 Bacteria 13616
57 Ga0157372_10066167 3300013307 Bacteria 4060
58 Ga0157372_10076241 3300013307 Bacteria 3786
59 Ga0157372_10530148 3300013307 Bacteria 1373
60 Ga0213876_10092739 3300021384 Bacteria 1600
61 Ga0213875_10000005 3300021388 Bacteria 595146
62 Ga0213875_10000010 3300021388 Bacteria 370268
63 Ga0213875_10001315 3300021388 Bacteria 16438
64 Ga0213875_10002081 3300021388 Bacteria 12272
65 Ga0213875_10036005 3300021388 Bacteria 2334
66 Ga0213871_10004677 3300021441 Bacteria 2758
67 Ga0209233_1014396 3300025261 Bacteria 2228
68 Ga0207705_10004967 3300025909 Bacteria 9983
69 Ga0207705_10009636 3300025909 Bacteria 7024
70 Ga0207695_10000001 3300025913 Bacteria 2888630
71 Ga0207695_10000106 3300025913 Bacteria 253001
72 Ga0207657_10193504 3300025919 Bacteria 1639
73 Ga0207649_10038189 3300025920 Bacteria 2906
74 Ga0207652_10000468 3300025921 Bacteria 41390
75 Ga0207694_10012467 3300025924 Bacteria 6409
76 Ga0207694_10017526 3300025924 Bacteria 5414
77 Ga0207664_10066131 3300025929 Bacteria 2897
78 Ga0207664_10333539 3300025929 Bacteria 1340
79 Ga0207661_10028426 3300025944 Bacteria 4282
80 Ga0207667_10024435 3300025949 Bacteria 6634
81 Ga0207667_10211847 3300025949 Bacteria 1986
82 Ga0207712_10138188 3300025961 Bacteria 1866
83 Ga0207640_10419254 3300025981 Bacteria 1095
84 Ga0207678_10075536 3300026067 Bacteria 2886
85 Ga0207678_10272657 3300026067 Unclassified 1451
86 Ga0207702_10015131 3300026078 Bacteria 6397
87 Ga0207702_10057322 3300026078 Bacteria 3311
88 Ga0207674_10057054 3300026116 Bacteria 3960
89 Ga0207698_10193102 3300026142 Bacteria 1816
90 Ga0207698_10625240 3300026142 Bacteria 1064
91 Ga0268266_10035502 3300028379 Bacteria 4241
92 Ga0268265_10086312 3300028380 Bacteria 2494
93 Ga0268264_10333585 3300028381 Bacteria 1438
94 Ga0265338_10057236 3300028800 Bacteria 3450
95 Ga0395900_0108865 3300037418 Bacteria 2847
96 Ga0395898_0264514 3300037466 Bacteria 1640
97 Ga0395905_0004593 3300037471 Bacteria 14285
98 Ga0436364_0082007 3300037853 Bacteria 8429
99 Ga0436364_0317618 3300037853 Bacteria 89116
100 Ga0436364_0535331 3300037853 Bacteria 45862
101 Ga0436364_0691473 3300037853 Bacteria 6955
102 Ga0436364_1343448 3300037853 Bacteria 154245
103 Ga0436365_0061898 3300039437 Bacteria 5724
104 Ga0436365_0564115 3300039437 Bacteria 2315
105 Ga0436365_0883677 3300039437 Bacteria 3794
106 Ga0436365_1026412 3300039437 Bacteria 2020
107 Ga0436365_1876494 3300039437 Bacteria 6765
108 Ga0436360_0328704 3300039438 Bacteria 7560
109 Ga0436361_0207335 3300039447 Bacteria 51296
110 Ga0436363_0059899 3300039450 Bacteria 2002
111 Ga0436363_0949376 3300039450 Bacteria 13141
112 Ga0436363_1662731 3300039450 Unclassified 3657
113 Ga0439448_0004754 3300042005 Bacteria 3844
114 Ga0466961_0285050 3300044693 Bacteria 1010
115 Ga0466963_0136629 3300044694 Bacteria 1697
116 Ga0451576_0431516 3300045051 Bacteria 1383
117 Ga0466967_0374564 3300045976 Bacteria 1381
118 Ga0495651_0021570 3300046462 Bacteria 5006
119 Ga0495580_0248441 3300046472 Unclassified 1218
120 Ga0495587_0015409 3300046536 Bacteria 4775
121 Ga0495645_0061067 3300046543 Bacteria 2731
122 Ga0495645_0066802 3300046543 Bacteria 2597
123 Ga0495646_0123650 3300046680 Bacteria 1462
124 Ga0495600_0178197 3300046809 Bacteria 1370
125 Ga0495686_0000427 3300047472 Bacteria 66176
126 Ga0495686_0002036 3300047472 Bacteria 19923
127 Ga0495686_0003407 3300047472 Bacteria 13829
128 Ga0496115_0038599 3300048918 Bacteria 3790
129 Ga0501032_0195482 3300049569 Bacteria 1321
130 Ga0501033_0039777 3300049570 Bacteria 3512
131 Ga0501034_0012394 3300049571 Bacteria 8806
132 Ga0501037_0257459 3300049573 Bacteria 1220
133 Ga0501046_0086811 3300049580 Bacteria 2412
134 Ga0501047_0008934 3300049581 Bacteria 9461
135 Ga0501047_0032540 3300049581 Bacteria 5034
136 Ga0501069_0192610 3300049585 Unclassified 1180
137 Ga0501080_0381106 3300049742 Bacteria 1271
138 Ga0501035_0032911 3300049822 Bacteria 4715
139 Ga0501035_0282187 3300049822 Bacteria 1403
140 Ga0501044_0002075 3300049823 Bacteria 23082
141 Ga0501044_0126769 3300049823 Bacteria 2549
142 Ga0501044_0165821 3300049823 Bacteria 2183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0192610 Ga0501069_0192610_37_834 260
2 3300049742 Ga0501080_0381106 Ga0501080_0381106_56_853 260
3 3300049823 Ga0501044_0126769 Ga0501044_0126769_142_939 260
4 3300044693 Ga0466961_0285050 Ga0466961_0285050_17_838 269
5 3300039437 Ga0436365_1026412 Ga0436365_1026412_635_1525 278
6 3300037853 Ga0436364_0082007 Ga0436364_0082007_3488_4399 279
7 3300021388 Ga0213875_10036005 Ga0213875_100360052 283
8 3300037853 Ga0436364_0691473 Ga0436364_0691473_3000_3911 283
9 3300039437 Ga0436365_1876494 Ga0436365_1876494_5002_5913 283
10 3300025913 Ga0207695_10000001 Ga0207695_100000011903 286
11 3300047472 Ga0495686_0003407 Ga0495686_0003407_7246_8151 288
12 3300005327 Ga0070658_10007579 Ga0070658_100075798 292
13 3300005329 Ga0070683_100038109 Ga0070683_1000381094 292
14 3300005339 Ga0070660_100159313 Ga0070660_1001593132 292
15 3300005539 Ga0068853_100012665 Ga0068853_1000126655 292
16 3300005563 Ga0068855_100010188 Ga0068855_10001018812 292
17 3300005616 Ga0068852_100011913 Ga0068852_1000119136 292
18 3300009093 Ga0105240_10000498 Ga0105240_1000049874 292
19 3300009093 Ga0105240_10279347 Ga0105240_102793472 292
20 3300009551 Ga0105238_10003188 Ga0105238_1000318815 292
21 3300010375 Ga0105239_10213062 Ga0105239_102130623 292
22 3300013105 Ga0157369_10015791 Ga0157369_100157916 292
23 3300013105 Ga0157369_10141254 Ga0157369_101412542 292
24 3300013307 Ga0157372_10005374 Ga0157372_1000537415 292
25 3300013307 Ga0157372_10530148 Ga0157372_105301481 292
26 3300025909 Ga0207705_10004967 Ga0207705_100049678 292
27 3300025913 Ga0207695_10000106 Ga0207695_1000010682 292
28 3300025919 Ga0207657_10193504 Ga0207657_101935042 292
29 3300025920 Ga0207649_10038189 Ga0207649_100381893 292
30 3300025924 Ga0207694_10012467 Ga0207694_100124672 292
31 3300025929 Ga0207664_10066131 Ga0207664_100661312 292
32 3300025944 Ga0207661_10028426 Ga0207661_100284264 292
33 3300025949 Ga0207667_10024435 Ga0207667_100244357 292
34 3300025949 Ga0207667_10211847 Ga0207667_102118472 292
35 3300026142 Ga0207698_10625240 Ga0207698_106252401 292
36 3300005549 Ga0070704_100087627 Ga0070704_1000876272 293
37 3300009553 Ga0105249_10129415 Ga0105249_101294151 293
38 3300021384 Ga0213876_10092739 Ga0213876_100927392 293
39 3300021441 Ga0213871_10004677 Ga0213871_100046772 293
40 3300028380 Ga0268265_10086312 Ga0268265_100863122 293
41 3300028800 Ga0265338_10057236 Ga0265338_100572362 293
42 3300039437 Ga0436365_0564115 Ga0436365_0564115_162_1055 293
43 3300039438 Ga0436360_0328704 Ga0436360_0328704_5802_6701 293
44 3300039447 Ga0436361_0207335 Ga0436361_0207335_12145_13038 293
45 3300005327 Ga0070658_10000142 Ga0070658_1000014245 294
46 3300005327 Ga0070658_10007501 Ga0070658_100075014 294
47 3300005327 Ga0070658_10012355 Ga0070658_100123554 294
48 3300005327 Ga0070658_10021779 Ga0070658_100217797 294
49 3300005327 Ga0070658_10123655 Ga0070658_101236552 294
50 3300005327 Ga0070658_10212043 Ga0070658_102120432 294
51 3300005329 Ga0070683_100046105 Ga0070683_1000461052 294
52 3300005336 Ga0070680_100087037 Ga0070680_1000870372 294
53 3300005435 Ga0070714_100205291 Ga0070714_1002052911 294
54 3300005435 Ga0070714_100378459 Ga0070714_1003784591 294
55 3300005435 Ga0070714_100451075 Ga0070714_1004510752 294
56 3300005455 Ga0070663_100098969 Ga0070663_1000989692 294
57 3300005455 Ga0070663_100113196 Ga0070663_1001131961 294
58 3300005530 Ga0070679_100000399 Ga0070679_10000039931 294
59 3300005530 Ga0070679_100007882 Ga0070679_1000078824 294
60 3300005530 Ga0070679_100135438 Ga0070679_1001354382 294
61 3300005545 Ga0070695_100089525 Ga0070695_1000895252 294
62 3300005548 Ga0070665_100057735 Ga0070665_1000577352 294
63 3300005563 Ga0068855_100040587 Ga0068855_1000405878 294
64 3300005614 Ga0068856_100013033 Ga0068856_1000130338 294
65 3300005617 Ga0068859_100281005 Ga0068859_1002810052 294
66 3300005844 Ga0068862_100027579 Ga0068862_1000275793 294
67 3300006028 Ga0070717_10199476 Ga0070717_101994761 294
68 3300006931 Ga0097620_100280995 Ga0097620_1002809952 294
69 3300009093 Ga0105240_10000001 Ga0105240_100000011900 294
70 3300009174 Ga0105241_10612063 Ga0105241_106120631 294
71 3300009177 Ga0105248_10435355 Ga0105248_104353551 294
72 3300009551 Ga0105238_10097742 Ga0105238_100977423 294
73 3300009551 Ga0105238_10313414 Ga0105238_103134142 294
74 3300009553 Ga0105249_10034371 Ga0105249_100343715 294
75 3300013104 Ga0157370_10044647 Ga0157370_100446472 294
76 3300013105 Ga0157369_10055943 Ga0157369_100559432 294
77 3300013105 Ga0157369_10083561 Ga0157369_100835612 294
78 3300013105 Ga0157369_10139414 Ga0157369_101394142 294
79 3300013105 Ga0157369_10156923 Ga0157369_101569232 294
80 3300013105 Ga0157369_10265636 Ga0157369_102656362 294
81 3300013296 Ga0157374_10036568 Ga0157374_100365685 294
82 3300013307 Ga0157372_10066167 Ga0157372_100661672 294
83 3300013307 Ga0157372_10076241 Ga0157372_100762414 294
84 3300021388 Ga0213875_10000005 Ga0213875_1000000578 294
85 3300021388 Ga0213875_10000010 Ga0213875_1000001061 294
86 3300021388 Ga0213875_10001315 Ga0213875_1000131514 294
87 3300021388 Ga0213875_10002081 Ga0213875_100020814 294
88 3300025261 Ga0209233_1014396 Ga0209233_10143962 294
89 3300025909 Ga0207705_10009636 Ga0207705_100096363 294
90 3300025921 Ga0207652_10000468 Ga0207652_100004686 294
91 3300025924 Ga0207694_10017526 Ga0207694_100175264 294
92 3300025929 Ga0207664_10333539 Ga0207664_103335392 294
93 3300025961 Ga0207712_10138188 Ga0207712_101381882 294
94 3300025981 Ga0207640_10419254 Ga0207640_104192542 294
95 3300026067 Ga0207678_10075536 Ga0207678_100755363 294
96 3300026067 Ga0207678_10272657 Ga0207678_102726571 294
97 3300026078 Ga0207702_10015131 Ga0207702_100151312 294
98 3300026078 Ga0207702_10057322 Ga0207702_100573222 294
99 3300026116 Ga0207674_10057054 Ga0207674_100570543 294
100 3300026142 Ga0207698_10193102 Ga0207698_101931022 294
101 3300028379 Ga0268266_10035502 Ga0268266_100355022 294
102 3300028381 Ga0268264_10333585 Ga0268264_103335851 294
103 3300037418 Ga0395900_0108865 Ga0395900_0108865_1364_2260 294
104 3300037466 Ga0395898_0264514 Ga0395898_0264514_248_1144 294
105 3300037471 Ga0395905_0004593 Ga0395905_0004593_3779_4675 294
106 3300037853 Ga0436364_0317618 Ga0436364_0317618_19316_20212 294
107 3300037853 Ga0436364_0535331 Ga0436364_0535331_861_1763 294
108 3300037853 Ga0436364_1343448 Ga0436364_1343448_13033_13947 294
109 3300039437 Ga0436365_0061898 Ga0436365_0061898_3234_4145 294
110 3300039437 Ga0436365_0883677 Ga0436365_0883677_2882_3784 294
111 3300039450 Ga0436363_0059899 Ga0436363_0059899_366_1262 294
112 3300039450 Ga0436363_0949376 Ga0436363_0949376_1786_2685 294
113 3300039450 Ga0436363_1662731 Ga0436363_1662731_115_1026 294
114 3300042005 Ga0439448_0004754 Ga0439448_0004754_1559_2455 294
115 3300044694 Ga0466963_0136629 Ga0466963_0136629_65_964 294
116 3300045051 Ga0451576_0431516 Ga0451576_0431516_217_1137 294
117 3300045976 Ga0466967_0374564 Ga0466967_0374564_29_949 294
118 3300046462 Ga0495651_0021570 Ga0495651_0021570_112_1083 294
119 3300046472 Ga0495580_0248441 Ga0495580_0248441_75_971 294
120 3300046536 Ga0495587_0015409 Ga0495587_0015409_282_1253 294
121 3300046543 Ga0495645_0061067 Ga0495645_0061067_559_1530 294
122 3300046543 Ga0495645_0066802 Ga0495645_0066802_1570_2541 294
123 3300046680 Ga0495646_0123650 Ga0495646_0123650_81_1052 294
124 3300046809 Ga0495600_0178197 Ga0495600_0178197_98_1069 294
125 3300047472 Ga0495686_0000427 Ga0495686_0000427_60599_61510 294
126 3300047472 Ga0495686_0002036 Ga0495686_0002036_15734_16714 294
127 3300048918 Ga0496115_0038599 Ga0496115_0038599_1468_2385 294
128 3300049569 Ga0501032_0195482 Ga0501032_0195482_74_973 294
129 3300049570 Ga0501033_0039777 Ga0501033_0039777_1659_2558 294
130 3300049571 Ga0501034_0012394 Ga0501034_0012394_6201_7100 294
131 3300049573 Ga0501037_0257459 Ga0501037_0257459_145_1044 294
132 3300049580 Ga0501046_0086811 Ga0501046_0086811_1028_1927 294
133 3300049581 Ga0501047_0008934 Ga0501047_0008934_4544_5443 294
134 3300049581 Ga0501047_0032540 Ga0501047_0032540_3305_4204 294
135 3300049822 Ga0501035_0032911 Ga0501035_0032911_2873_3772 294
136 3300049822 Ga0501035_0282187 Ga0501035_0282187_59_958 294
137 3300049823 Ga0501044_0002075 Ga0501044_0002075_15609_16508 294
138 3300049823 Ga0501044_0165821 Ga0501044_0165821_515_1414 294
139 3300005290 Ga0065712_10088974 Ga0065712_100889742 295
140 3300005327 Ga0070658_10094645 Ga0070658_100946453 295
141 3300005364 Ga0070673_100046051 Ga0070673_1000460512 295
142 3300005367 Ga0070667_100305938 Ga0070667_1003059382 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

53

323

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f7q-assembly1.cif.gz_C rok repressor lmo0178 from listeria monocytogenes bound to operator 0.8183 2 295
5f7q-assembly1.cif.gz_C rok repressor lmo0178 from listeria monocytogenes bound to operator 0.8133 2 295
5f7p-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes 0.7985 2 291
5f7p-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes 0.7838 2 291
7p9l-assembly1.cif.gz_BBB n-acetylglucosamine kinase from plesiomonas shigelloides compexed with alpha-n-acetylglucosamine-6-phosphate 0.7824 2 287
ID Description Score Start End Superfamily
3vgkB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8639 3 131 3.30.420.40
3vovB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.862 3 124 3.30.420.40
2ap1A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8264 1 124 3.30.420.40
af_P75959_104_302_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7962 114 286 3.30.420.40
af_P23917_121_283_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7902 133 274 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2N9MIM8-F1-model_v4 ROK family protein 0.9727 67 290 GO:0003824
AF-A0A7C2J8R5-F1-model_v4 ROK family protein 0.9657 122 295 GO:0003824
AF-A0A7W1LY82-F1-model_v4 ROK family protein 0.9652 139 294
AF-A0A7C2J8R5-F1-model_v4 ROK family protein 0.9497 122 295 GO:0003824
AF-A0A7V9TDY3-F1-model_v4 ROK family protein 0.9459 194 294

Feature Viewer

pLDDT pTM Quality
86.93 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map