F186446

General Info

Members Datasets Scaffolds Average Seq Length
142 71 284 165

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0499458|Ga0436363_0499458_1194_1712
Length 172
Sequence VREPQAHGRGADAFAGLMFSDVDGAVEWREAQRAAGRRVVSTNGVFDLLHAGHVAYLAWARAQGDALIVLLNEDDSVRLLGKGPDRPLVPFAERARVVAALRSVDAVVGFRQRTPETLLERIRPDVHVKSAQYRIEELPERYVVEHHGGRIVLAPHEPGRSTTDLVATIRSR

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
19 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
21 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
22 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
23 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
24 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
25 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
26 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
41 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
47 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
48 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
49 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
53 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 2.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 81.69
Stem 0
Stem Tuber 0
Unclassified 19.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0499458 3300039450 Bacteria 1800
2 Ga0070683_100105054 3300005329 Bacteria 2662
3 Ga0070682_100786845 3300005337 Bacteria 771
4 Ga0070691_10002113 3300005341 Bacteria 8798
5 Ga0070661_100024155 3300005344 Bacteria 4360
6 Ga0070714_100004571 3300005435 Bacteria 10437
7 Ga0070714_100019270 3300005435 Bacteria 5553
8 Ga0070714_100029932 3300005435 Unclassified 4530
9 Ga0070714_101128383 3300005435 Unclassified 764
10 Ga0070663_100076007 3300005455 Bacteria 2455
11 Ga0070663_100082498 3300005455 Unclassified 2365
12 Ga0070679_100040143 3300005530 Bacteria 4656
13 Ga0068853_100088269 3300005539 Unclassified 2722
14 Ga0068853_100470260 3300005539 Bacteria 1184
15 Ga0068855_100000687 3300005563 Bacteria 41298
16 Ga0068855_100004005 3300005563 Bacteria 17986
17 Ga0068854_100000002 3300005578 Bacteria 362695
18 Ga0068856_100008238 3300005614 Bacteria 10163
19 Ga0068856_100061524 3300005614 Bacteria 3709
20 Ga0068852_100021039 3300005616 Bacteria 5198
21 Ga0070717_10504207 3300006028 Unclassified 1094
22 Ga0105240_10467637 3300009093 Unclassified 1408
23 Ga0105238_10524571 3300009551 Unclassified 1187
24 Ga0157370_11277357 3300013104 Bacteria 662
25 Ga0157374_10125445 3300013296 Unclassified 2481
26 Ga0206356_11577967 3300020070 Bacteria 13635
27 Ga0213873_10000155 3300021358 Bacteria 13131
28 Ga0213873_10008044 3300021358 Bacteria 2138
29 Ga0213873_10280967 3300021358 Bacteria 533
30 Ga0213872_10002729 3300021361 Bacteria 10140
31 Ga0213872_10003793 3300021361 Bacteria 8242
32 Ga0213874_10000077 3300021377 Bacteria 14828
33 Ga0213874_10007958 3300021377 Bacteria 2566
34 Ga0213876_10001328 3300021384 Bacteria 15524
35 Ga0213876_10036542 3300021384 Unclassified 2590
36 Ga0213875_10004293 3300021388 Bacteria 7850
37 Ga0213875_10037471 3300021388 Bacteria 2285
38 Ga0213875_10211242 3300021388 Bacteria 913
39 Ga0213871_10002589 3300021441 Bacteria 3346
40 Ga0213871_10079422 3300021441 Bacteria 938
41 Ga0213871_10093768 3300021441 Bacteria 872
42 Ga0207707_10182888 3300025912 Bacteria 1830
43 Ga0207695_10333800 3300025913 Unclassified 1404
44 Ga0207660_10660894 3300025917 Bacteria 852
45 Ga0207649_10086294 3300025920 Bacteria 2045
46 Ga0207652_10075535 3300025921 Bacteria 2937
47 Ga0207694_10353312 3300025924 Unclassified 1217
48 Ga0207664_10003420 3300025929 Bacteria 10580
49 Ga0207664_10385795 3300025929 Unclassified 1244
50 Ga0207664_10403138 3300025929 Unclassified 1216
51 Ga0207664_10992722 3300025929 Unclassified 752
52 Ga0207661_10082224 3300025944 Bacteria 2662
53 Ga0207667_10000161 3300025949 Bacteria 98927
54 Ga0207667_10001004 3300025949 Bacteria 36004
55 Ga0207667_10671378 3300025949 Bacteria 1040
56 Ga0207640_10000006 3300025981 Bacteria 313289
57 Ga0207639_10067155 3300026041 Unclassified 2790
58 Ga0207639_10436281 3300026041 Bacteria 1187
59 Ga0207678_10176729 3300026067 Bacteria 1823
60 Ga0207678_10744989 3300026067 Bacteria 864
61 Ga0207702_10006595 3300026078 Bacteria 9978
62 Ga0207702_10020024 3300026078 Bacteria 5544
63 Ga0207698_10512043 3300026142 Unclassified 1170
64 Ga0265356_1000422 3300028017 Bacteria 7683
65 Ga0265334_10013292 3300028573 Bacteria 3448
66 Ga0265338_10000238 3300028800 Bacteria 101800
67 Ga0265770_1001452 3300030878 Bacteria 3255
68 Ga0265773_1028436 3300031018 Unclassified 588
69 Ga0265332_10013745 3300031238 Bacteria 3583
70 Ga0265325_10000256 3300031241 Bacteria 37890
71 Ga0265329_10034765 3300031242 Bacteria 1628
72 Ga0265340_10003892 3300031247 Bacteria 8414
73 Ga0265339_10013595 3300031249 Unclassified 4930
74 Ga0265327_10009184 3300031251 Bacteria 7180
75 Ga0265316_10010659 3300031344 Bacteria 8356
76 Ga0265313_10000911 3300031595 Bacteria 29567
77 Ga0265342_10007658 3300031712 Bacteria 7866
78 Ga0395899_0001993 3300037312 Bacteria 16806
79 Ga0395900_0119142 3300037418 Bacteria 2709
80 Ga0395898_0037761 3300037466 Bacteria 4789
81 Ga0395905_0829982 3300037471 Bacteria 827
82 Ga0436364_0068820 3300037853 Bacteria 44278
83 Ga0436364_0202176 3300037853 Bacteria 41706
84 Ga0436364_0273345 3300037853 Bacteria 2794207
85 Ga0436364_0400539 3300037853 Bacteria 1774
86 Ga0436364_0455822 3300037853 Bacteria 11040
87 Ga0436364_1479870 3300037853 Bacteria 1389
88 Ga0395901_0045461 3300038443 Bacteria 4556
89 Ga0436365_0409489 3300039437 Bacteria 627
90 Ga0436365_0898977 3300039437 Bacteria 71829
91 Ga0436365_1212584 3300039437 Unclassified 2693
92 Ga0436365_1717380 3300039437 Bacteria 2205
93 Ga0436360_0134685 3300039438 Bacteria 1306
94 Ga0436360_0262048 3300039438 Bacteria 2522
95 Ga0436360_0430521 3300039438 Unclassified 2729
96 Ga0436360_0491616 3300039438 Bacteria 2036
97 Ga0436360_0554044 3300039438 Bacteria 981
98 Ga0436360_0594311 3300039438 Bacteria 1726
99 Ga0436360_0853563 3300039438 Unclassified 1717
100 Ga0436360_1064493 3300039438 Bacteria 1848
101 Ga0436360_1151499 3300039438 Unclassified 806
102 Ga0436360_1226066 3300039438 Bacteria 2931
103 Ga0436361_0033268 3300039447 Bacteria 29597
104 Ga0436361_0098710 3300039447 Bacteria 2664
105 Ga0436361_0128032 3300039447 Bacteria 1333
106 Ga0436361_0222941 3300039447 Bacteria 2756
107 Ga0436361_0434945 3300039447 Unclassified 1771
108 Ga0436361_0497161 3300039447 Bacteria 14089
109 Ga0436361_0576711 3300039447 Bacteria 25198
110 Ga0436361_0946987 3300039447 Bacteria 1530
111 Ga0436361_1141113 3300039447 Bacteria 3241
112 Ga0436361_1149251 3300039447 Bacteria 6274
113 Ga0436363_0238460 3300039450 Bacteria 21939
114 Ga0436363_0279536 3300039450 Bacteria 909
115 Ga0436363_0606008 3300039450 Unclassified 759
116 Ga0436363_0613399 3300039450 Bacteria 2245
117 Ga0436363_1060650 3300039450 Bacteria 840
118 Ga0436363_1132178 3300039450 Unclassified 1170
119 Ga0436363_1407637 3300039450 Bacteria 573
120 Ga0436363_1495164 3300039450 Bacteria 4579
121 Ga0436362_0037111 3300039453 Bacteria 12704
122 Ga0436362_0134252 3300039453 Bacteria 1610
123 Ga0436362_0165132 3300039453 Bacteria 31841
124 Ga0436362_0249594 3300039453 Bacteria 615
125 Ga0436362_0259863 3300039453 Bacteria 2860
126 Ga0436362_0384945 3300039453 Bacteria 1000
127 Ga0436362_0398207 3300039453 Bacteria 8325
128 Ga0436362_0416803 3300039453 Bacteria 3792
129 Ga0436362_0543597 3300039453 Bacteria 1452
130 Ga0436362_0933130 3300039453 Unclassified 986
131 Ga0436362_1014931 3300039453 Bacteria 6951
132 Ga0451577_0660863 3300042876 Bacteria 947
133 Ga0466966_0032668 3300044684 Bacteria 3371
134 Ga0466963_0001510 3300044694 Bacteria 12582
135 Ga0466963_0099694 3300044694 Bacteria 1987
136 Ga0466957_0284121 3300044842 Bacteria 1108
137 Ga0466959_0490941 3300045049 Bacteria 830
138 Ga0466958_0000603 3300045836 Bacteria 15357
139 Ga0466958_0077540 3300045836 Bacteria 2041
140 Ga0466967_0006477 3300045976 Bacteria 8293
141 Ga0466967_1718518 3300045976 Unclassified 625
142 Ga0501072_0538366 3300049588 Bacteria 923
143 Ga0436363_0499458
144 Ga0070683_100105054
145 Ga0070682_100786845
146 Ga0070691_10002113
147 Ga0070661_100024155
148 Ga0070714_100004571
149 Ga0070714_100019270
150 Ga0070714_100029932
151 Ga0070714_101128383
152 Ga0070663_100076007
153 Ga0070663_100082498
154 Ga0070679_100040143
155 Ga0068853_100088269
156 Ga0068853_100470260
157 Ga0068855_100000687
158 Ga0068855_100004005
159 Ga0068854_100000002
160 Ga0068856_100008238
161 Ga0068856_100061524
162 Ga0068852_100021039
163 Ga0070717_10504207
164 Ga0105240_10467637
165 Ga0105238_10524571
166 Ga0157370_11277357
167 Ga0157374_10125445
168 Ga0206356_11577967
169 Ga0213873_10000155
170 Ga0213873_10008044
171 Ga0213873_10280967
172 Ga0213872_10002729
173 Ga0213872_10003793
174 Ga0213874_10000077
175 Ga0213874_10007958
176 Ga0213876_10001328
177 Ga0213876_10036542
178 Ga0213875_10004293
179 Ga0213875_10037471
180 Ga0213875_10211242
181 Ga0213871_10002589
182 Ga0213871_10079422
183 Ga0213871_10093768
184 Ga0207707_10182888
185 Ga0207695_10333800
186 Ga0207660_10660894
187 Ga0207649_10086294
188 Ga0207652_10075535
189 Ga0207694_10353312
190 Ga0207664_10003420
191 Ga0207664_10385795
192 Ga0207664_10403138
193 Ga0207664_10992722
194 Ga0207661_10082224
195 Ga0207667_10000161
196 Ga0207667_10001004
197 Ga0207667_10671378
198 Ga0207640_10000006
199 Ga0207639_10067155
200 Ga0207639_10436281
201 Ga0207678_10176729
202 Ga0207678_10744989
203 Ga0207702_10006595
204 Ga0207702_10020024
205 Ga0207698_10512043
206 Ga0265356_1000422
207 Ga0265334_10013292
208 Ga0265338_10000238
209 Ga0265770_1001452
210 Ga0265773_1028436
211 Ga0265332_10013745
212 Ga0265325_10000256
213 Ga0265329_10034765
214 Ga0265340_10003892
215 Ga0265339_10013595
216 Ga0265327_10009184
217 Ga0265316_10010659
218 Ga0265313_10000911
219 Ga0265342_10007658
220 Ga0395899_0001993
221 Ga0395900_0119142
222 Ga0395898_0037761
223 Ga0395905_0829982
224 Ga0436364_0068820
225 Ga0436364_0202176
226 Ga0436364_0273345
227 Ga0436364_0400539
228 Ga0436364_0455822
229 Ga0436364_1479870
230 Ga0395901_0045461
231 Ga0436365_0409489
232 Ga0436365_0898977
233 Ga0436365_1212584
234 Ga0436365_1717380
235 Ga0436360_0134685
236 Ga0436360_0262048
237 Ga0436360_0430521
238 Ga0436360_0491616
239 Ga0436360_0554044
240 Ga0436360_0594311
241 Ga0436360_0853563
242 Ga0436360_1064493
243 Ga0436360_1151499
244 Ga0436360_1226066
245 Ga0436361_0033268
246 Ga0436361_0098710
247 Ga0436361_0128032
248 Ga0436361_0222941
249 Ga0436361_0434945
250 Ga0436361_0497161
251 Ga0436361_0576711
252 Ga0436361_0946987
253 Ga0436361_1141113
254 Ga0436361_1149251
255 Ga0436363_0238460
256 Ga0436363_0279536
257 Ga0436363_0606008
258 Ga0436363_0613399
259 Ga0436363_1060650
260 Ga0436363_1132178
261 Ga0436363_1407637
262 Ga0436363_1495164
263 Ga0436362_0037111
264 Ga0436362_0134252
265 Ga0436362_0165132
266 Ga0436362_0249594
267 Ga0436362_0259863
268 Ga0436362_0384945
269 Ga0436362_0398207
270 Ga0436362_0416803
271 Ga0436362_0543597
272 Ga0436362_0933130
273 Ga0436362_1014931
274 Ga0451577_0660863
275 Ga0466966_0032668
276 Ga0466963_0001510
277 Ga0466963_0099694
278 Ga0466957_0284121
279 Ga0466959_0490941
280 Ga0466958_0000603
281 Ga0466958_0077540
282 Ga0466967_0006477
283 Ga0466967_1718518
284 Ga0501072_0538366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

41

167

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9048 8 143
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8666 8 160
1n1d-assembly1.cif.gz_A glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol 0.8606 27 156
5x3d-assembly1.cif.gz_A-2 crystal structure of hep-cmp-bound form of cytidylyltransferase (cytase) domain of fom1 from streptomyces wedmorensis 0.8558 27 147
2b7l-assembly2.cif.gz_D crystal structure of ctp:glycerol-3-phosphate cytidylyltransferase from staphylococcus aureus 0.8544 27 144
ID Description Score Start End Superfamily
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9566 8 160 3.40.50.620
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9272 8 160 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8773 27 156 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8581 27 156 3.40.50.620
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8544 27 144 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A529L1G2-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9853 8 142 GO:0005524
GO:0005975
GO:0009058
GO:0016773
GO:0016779
AF-A0A3M2FLP0-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9819 8 147 GO:0005524
GO:0005829
GO:0009058
GO:0016773
GO:0033785
GO:0033786
AF-A0A7Y4QAX1-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9789 8 142 GO:0005524
GO:0005975
GO:0009058
GO:0016773
GO:0016779
AF-A0A1G0JID5-F1-model_v4 Bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase 0.9777 6 119 GO:0005829
GO:0009244
GO:0016773
GO:0033785
GO:0033786
AF-A0A383ARG4-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.9753 7 126 GO:0003824
GO:0009058

Map