F185786

General Info

Members Datasets Scaffolds Average Seq Length
142 101 143 238

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10055329|Ga0157380_100553292
Length 247
Sequence MMIIAKREFRSYFDSPLAYVVICLSYFGLGLMFFTDTVGASFWKVDKASLTDLFVYVGPGLSALVVPVVTMALVAEERRSGTLEMLITLPVKDSDVIVGKYLGALGLVLTLLLALLIYPIAMFSWPWQLGNLDWGPVLSAILGLVLFSAASVAIGLLVSALMRSQAVAFFVTFFVLVVLWILGALTDYVGQDISQGLANFMGYISFNSRLQGFIRGLVDTRDIVYFISVTLLALVFAFRALERRKWA

Samples

Sample ID Description Type Environment
1 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
42 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
43 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
64 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
65 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
66 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
67 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
68 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
75 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
76 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
82 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
83 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
84 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
85 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
86 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
87 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
93 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
94 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
95 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
96 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
97 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 5.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 2.11
Rhizosphere 77.46
Stem 0
Stem Tuber 0
Unclassified 16.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1058602 3300003163 Bacteria 2733
2 Ga0006770J48903_1051649 3300003305 Unclassified 1521
3 rootH1_10087723 3300003316 Bacteria 1271
4 rootH2_10007890 3300003320 Bacteria 24536
5 rootH2_10096407 3300003320 Bacteria 1238
6 rootL2_10004478 3300003322 Bacteria 1717
7 rootL2_10061719 3300003322 Bacteria 1481
8 rootH1_10016525 3300003316 Bacteria 14132
9 rootH1_10016525 3300003323 Bacteria 5227
10 rootH1_10085269 3300003323 Bacteria 1030
11 rootH1_10114430 3300003323 Bacteria 2188
12 rootH1_10179611 3300003323 Bacteria 1380
13 rootH1_10179612 3300003323 Bacteria 1502
14 rootH1_10179613 3300003323 Unclassified 1142
15 rootH1_10193418 3300003323 Bacteria 1389
16 Ga0070680_100305466 3300005336 Bacteria 1349
17 Ga0070682_100000696 3300005337 Bacteria 20199
18 Ga0070682_100001268 3300005337 Bacteria 14336
19 Ga0070682_100014021 3300005337 Unclassified 4625
20 Ga0070682_100101108 3300005337 Bacteria 1903
21 Ga0070682_100218442 3300005337 Bacteria 1355
22 Ga0070675_100746365 3300005354 Bacteria 893
23 Ga0070678_100022449 3300005456 Bacteria 4183
24 Ga0070678_100245874 3300005456 Bacteria 1498
25 Ga0070707_100032992 3300005468 Bacteria 4935
26 Ga0070672_100001574 3300005543 Bacteria 14123
27 Ga0070672_100286751 3300005543 Bacteria 1393
28 Ga0070693_100301171 3300005547 Unclassified 1081
29 Ga0070665_100418316 3300005548 Bacteria 1349
30 Ga0068855_100000150 3300005563 Bacteria 88674
31 Ga0068855_100007617 3300005563 Bacteria 13092
32 Ga0068856_100009349 3300005614 Bacteria 9520
33 Ga0068852_100102521 3300005616 Bacteria 2586
34 Ga0068859_100186406 3300005617 Bacteria 2159
35 Ga0068861_100005977 3300005719 Bacteria 8267
36 Ga0075366_10009927 3300006195 Bacteria 5329
37 Ga0097621_100032029 3300006237 Bacteria 4177
38 Ga0097621_100532425 3300006237 Bacteria 1068
39 Ga0068871_100130935 3300006358 Bacteria 2127
40 Ga0097620_100186405 3300006931 Bacteria 2159
41 Ga0075435_100003243 3300007076 Bacteria 11018
42 Ga0111539_10005404 3300009094 Bacteria 16531
43 Ga0111539_10068436 3300009094 Bacteria 4192
44 Ga0111539_10536513 3300009094 Bacteria 1363
45 Ga0105245_10001776 3300009098 Bacteria 19646
46 Ga0105241_10002109 3300009174 Bacteria 15016
47 Ga0105238_10595132 3300009551 Bacteria 1113
48 Ga0105249_10057090 3300009553 Bacteria 3575
49 Ga0157380_10055329 3300014326 Bacteria 3151
50 Ga0207654_10030844 3300025911 Bacteria 2947
51 Ga0207646_10080217 3300025922 Bacteria 2918
52 Ga0207694_10194036 3300025924 Bacteria 1651
53 Ga0207687_10002014 3300025927 Bacteria 13945
54 Ga0207691_10001208 3300025940 Bacteria 25729
55 Ga0207691_10496034 3300025940 Bacteria 1037
56 Ga0207667_10006963 3300025949 Bacteria 13668
57 Ga0207667_10059241 3300025949 Bacteria 4011
58 Ga0207677_10046945 3300026023 Bacteria 2896
59 Ga0207675_100017100 3300026118 Bacteria 6773
60 Ga0207683_10158351 3300026121 Bacteria 2046
61 Ga0207683_10243103 3300026121 Bacteria 1642
62 Ga0268264_10222391 3300028381 Bacteria 1739
63 Ga0265337_1003242 3300028556 Bacteria 7112
64 Ga0265334_10000212 3300028573 Bacteria 33286
65 Ga0265334_10045824 3300028573 Unclassified 1692
66 Ga0265318_10036121 3300028577 Unclassified 1897
67 Ga0265320_10001677 3300031240 Bacteria 15737
68 Ga0265320_10166931 3300031240 Unclassified 990
69 Ga0265340_10101021 3300031247 Unclassified 1340
70 Ga0265339_10006727 3300031249 Bacteria 7507
71 Ga0265316_10000572 3300031344 Bacteria 41172
72 Ga0307513_10086536 3300031456 Bacteria 3212
73 Ga0307508_10120553 3300031616 Bacteria 2225
74 Ga0307508_10125896 3300031616 Bacteria 2165
75 Ga0316579_10086808 3300031691 Bacteria 1493
76 Ga0265314_10000003 3300031711 Bacteria 1653386
77 Ga0265314_10025040 3300031711 Bacteria 4510
78 Ga0265314_10116599 3300031711 Bacteria 1688
79 Ga0316576_10015065 3300031727 Bacteria 5178
80 Ga0316576_10015495 3300031727 Bacteria 5118
81 Ga0316576_10133969 3300031727 Bacteria 1865
82 Ga0316576_10194347 3300031727 Bacteria 1529
83 Ga0316578_10050374 3300031728 Bacteria 2436
84 Ga0307516_10011525 3300031730 Bacteria 9596
85 Ga0307407_10008456 3300031903 Bacteria 4728
86 Ga0316574_0174525 3300035398 Bacteria 1383
87 Ga0373935_0110403 3300035692 Bacteria 1825
88 Ga0373927_0084964 3300035695 Bacteria 2053
89 Ga0373933_0053889 3300035724 Bacteria 2409
90 Ga0373937_0157299 3300036401 Bacteria 2130
91 Ga0316582_0189799 3300036647 Bacteria 1400
92 Ga0316582_0441196 3300036647 Bacteria 897
93 Ga0316584_0068347 3300036712 Bacteria 2663
94 Ga0400489_07539 3300039093 Bacteria 2536
95 Ga0400489_58588 3300039093 Bacteria 1072
96 Ga0451791_1884134 3300041451 Bacteria 1405
97 Ga0451802_0453897 3300041460 Bacteria 896
98 Ga0451807_0276411 3300041486 Bacteria 6173
99 Ga0451851_0226680 3300041507 Bacteria 2127
100 Ga0451853_0162710 3300041512 Bacteria 8567
101 Ga0451853_1722091 3300041512 Bacteria 1794
102 Ga0451853_2926981 3300041512 Bacteria 924
103 Ga0439449_0085911 3300042007 Bacteria 1161
104 Ga0453683_0057403 3300044673 Unclassified 2435
105 Ga0453683_0090502 3300044673 Bacteria 1918
106 Ga0453683_0334380 3300044673 Bacteria 972
107 Ga0466968_0184940 3300044735 Bacteria 970
108 Ga0451576_0104855 3300045051 Bacteria 2941
109 Ga0451576_0399181 3300045051 Bacteria 1441
110 Ga0495630_0201741 3300046517 Bacteria 1518
111 Ga0495680_0187441 3300047322 Bacteria 1490
112 Ga0496121_0259358 3300048924 Bacteria 1201
113 Ga0501323_004797 3300049539 Bacteria 1449
114 Ga0501034_0078082 3300049571 Bacteria 3316
115 Ga0501047_0224325 3300049581 Bacteria 1735
116 Ga0501071_0161796 3300049587 Bacteria 1673
117 Ga0501073_0017292 3300049589 Bacteria 5224
118 Ga0501074_0004890 3300049590 Bacteria 9608
119 Ga0501076_0120958 3300049592 Bacteria 2120
120 Ga0501077_0026060 3300049593 Bacteria 3710
121 Ga0501077_0109955 3300049593 Bacteria 1746
122 Ga0501206_015640 3300049653 Unclassified 1051
123 Ga0501235_009539 3300049669 Bacteria 2121
124 Ga0501080_0231852 3300049742 Unclassified 1687
125 Ga0501083_0000240 3300049744 Bacteria 35284
126 Ga0501083_0078938 3300049744 Bacteria 2183
127 Ga0501083_0084653 3300049744 Bacteria 2099
128 Ga0501035_0148406 3300049822 Bacteria 2036
129 nmdc:mga0k408_20810_c1 3300050493 Unclassified 3681
130 nmdc:mga08y16_66919_c1 3300050511 Bacteria 3749
131 nmdc:mga0rr50_15193_c1 3300050513 Bacteria 5076
132 Ga0500635_0005631 3300053080 Bacteria 3300
133 Ga0500644_0008856 3300053088 Bacteria 2670
134 Ga0500555_001124 3300053103 Bacteria 8843
135 Ga0500588_0018089 3300053146 Bacteria 1851
136 Ga0501084_0017361 3300054114 Bacteria 5981
137 Ga0501084_0552135 3300054114 Unclassified 973
138 Ga0587084_003588 3300059477 Bacteria 1716
139 Ga0587085_008791 3300059506 Bacteria 1298
140 Ga0587092_011340 3300059512 Bacteria 1237
141 Ga0587101_001129 3300059623 Bacteria 2196
142 Ga0587101_014658 3300059623 Bacteria 1050
143 Ga0501082_0071016 3300060353 Bacteria 2998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10007890 rootH2_100078902 204
2 3300025940 Ga0207691_10496034 Ga0207691_104960342 204
3 3300035724 Ga0373933_0053889 Ga0373933_0053889_593_1339 209
4 3300009553 Ga0105249_10057090 Ga0105249_100570901 211
5 3300031903 Ga0307407_10008456 Ga0307407_100084564 213
6 3300005719 Ga0068861_100005977 Ga0068861_1000059777 215
7 3300026118 Ga0207675_100017100 Ga0207675_1000171006 215
8 3300028381 Ga0268264_10222391 Ga0268264_102223911 215
9 3300045051 Ga0451576_0399181 Ga0451576_0399181_752_1411 218
10 3300049653 Ga0501206_015640 Ga0501206_015640_149_874 222
11 3300036647 Ga0316582_0441196 Ga0316582_0441196_158_880 223
12 3300005337 Ga0070682_100101108 Ga0070682_1001011082 224
13 3300005456 Ga0070678_100022449 Ga0070678_1000224495 224
14 3300005543 Ga0070672_100286751 Ga0070672_1002867512 224
15 3300026023 Ga0207677_10046945 Ga0207677_100469452 224
16 3300026121 Ga0207683_10158351 Ga0207683_101583512 224
17 3300009098 Ga0105245_10001776 Ga0105245_1000177610 225
18 3300009174 Ga0105241_10002109 Ga0105241_100021094 225
19 3300025911 Ga0207654_10030844 Ga0207654_100308442 225
20 3300025927 Ga0207687_10002014 Ga0207687_100020146 225
21 3300041460 Ga0451802_0453897 Ga0451802_0453897_27_752 225
22 3300041486 Ga0451807_0276411 Ga0451807_0276411_1185_1910 225
23 3300031727 Ga0316576_10133969 Ga0316576_101339692 226
24 3300005617 Ga0068859_100186406 Ga0068859_1001864062 227
25 3300006931 Ga0097620_100186405 Ga0097620_1001864052 227
26 3300039093 Ga0400489_58588 Ga0400489_58588_182_913 227
27 3300028573 Ga0265334_10045824 Ga0265334_100458242 229
28 3300028577 Ga0265318_10036121 Ga0265318_100361212 229
29 3300031240 Ga0265320_10166931 Ga0265320_101669312 229
30 3300031247 Ga0265340_10101021 Ga0265340_101010212 229
31 3300031711 Ga0265314_10025040 Ga0265314_100250402 229
32 3300059477 Ga0587084_003588 Ga0587084_003588_336_1070 233
33 3300003316 rootH1_10087723 rootH1_100877232 234
34 3300003323 rootH1_10179611 rootH1_101796111 234
35 3300003323 rootH1_10179612 rootH1_101796122 234
36 3300003323 rootH1_10193418 rootH1_101934182 234
37 3300005563 Ga0068855_100000150 Ga0068855_10000015077 234
38 3300025949 Ga0207667_10006963 Ga0207667_1000696314 234
39 3300031616 Ga0307508_10120553 Ga0307508_101205532 234
40 3300031730 Ga0307516_10011525 Ga0307516_100115257 234
41 3300035692 Ga0373935_0110403 Ga0373935_0110403_945_1679 234
42 3300035695 Ga0373927_0084964 Ga0373927_0084964_931_1665 234
43 3300041512 Ga0451853_1722091 Ga0451853_1722091_213_962 234
44 3300059623 Ga0587101_001129 Ga0587101_001129_902_1639 234
45 3300031727 Ga0316576_10194347 Ga0316576_101943472 235
46 3300044735 Ga0466968_0184940 Ga0466968_0184940_12_737 235
47 3300041507 Ga0451851_0226680 Ga0451851_0226680_150_884 236
48 3300003322 rootL2_10004478 rootL2_100044782 237
49 3300003323 rootH1_10085269 rootH1_100852691 237
50 3300048924 Ga0496121_0259358 Ga0496121_0259358_270_992 239
51 3300036647 Ga0316582_0189799 Ga0316582_0189799_549_1271 240
52 3300044673 Ga0453683_0090502 Ga0453683_0090502_1013_1735 240
53 3300059506 Ga0587085_008791 Ga0587085_008791_96_836 240
54 3300014326 Ga0157380_10055329 Ga0157380_100553292 241
55 3300035398 Ga0316574_0174525 Ga0316574_0174525_242_967 241
56 3300039093 Ga0400489_07539 Ga0400489_07539_1005_1736 241
57 3300041451 Ga0451791_1884134 Ga0451791_1884134_22_747 241
58 3300041512 Ga0451853_0162710 Ga0451853_0162710_39_779 241
59 3300044673 Ga0453683_0057403 Ga0453683_0057403_1196_1921 241
60 3300049587 Ga0501071_0161796 Ga0501071_0161796_101_829 241
61 3300049592 Ga0501076_0120958 Ga0501076_0120958_1308_2036 241
62 3300049593 Ga0501077_0026060 Ga0501077_0026060_1896_2639 241
63 3300049593 Ga0501077_0109955 Ga0501077_0109955_563_1303 241
64 3300053080 Ga0500635_0005631 Ga0500635_0005631_1998_2723 241
65 3300053103 Ga0500555_001124 Ga0500555_001124_5711_6454 241
66 3300053146 Ga0500588_0018089 Ga0500588_0018089_642_1385 241
67 3300005336 Ga0070680_100305466 Ga0070680_1003054662 243
68 3300005468 Ga0070707_100032992 Ga0070707_1000329922 243
69 3300007076 Ga0075435_100003243 Ga0075435_1000032435 243
70 3300009094 Ga0111539_10005404 Ga0111539_100054042 243
71 3300009094 Ga0111539_10068436 Ga0111539_100684362 243
72 3300009551 Ga0105238_10595132 Ga0105238_105951322 243
73 3300025922 Ga0207646_10080217 Ga0207646_100802172 243
74 3300025924 Ga0207694_10194036 Ga0207694_101940362 243
75 3300031691 Ga0316579_10086808 Ga0316579_100868082 243
76 3300031728 Ga0316578_10050374 Ga0316578_100503742 243
77 3300036401 Ga0373937_0157299 Ga0373937_0157299_762_1493 243
78 3300045051 Ga0451576_0104855 Ga0451576_0104855_1381_2115 243
79 3300047322 Ga0495680_0187441 Ga0495680_0187441_738_1469 243
80 3300049744 Ga0501083_0084653 Ga0501083_0084653_216_950 243
81 3300050511 nmdc:mga08y16_66919_c1 nmdc:mga08y16_66919_c1_636_1367 243
82 3300050513 nmdc:mga0rr50_15193_c1 nmdc:mga0rr50_15193_c1_4103_4834 243
83 3300059512 Ga0587092_011340 Ga0587092_011340_13_747 243
84 3300003163 Ga0006759J45824_1058602 Ga0006759J45824_10586022 244
85 3300003305 Ga0006770J48903_1051649 Ga0006770J48903_10516491 244
86 3300003320 rootH2_10096407 rootH2_100964072 244
87 3300003322 rootL2_10061719 rootL2_100617192 244
88 3300003323 rootH1_10016525 rootH1_100165253 244
89 3300003323 rootH1_10114430 rootH1_101144302 244
90 3300003323 rootH1_10179613 rootH1_101796131 244
91 3300005337 Ga0070682_100000696 Ga0070682_1000006962 244
92 3300005337 Ga0070682_100001268 Ga0070682_10000126811 244
93 3300005337 Ga0070682_100014021 Ga0070682_1000140213 244
94 3300005337 Ga0070682_100218442 Ga0070682_1002184422 244
95 3300005354 Ga0070675_100746365 Ga0070675_1007463652 244
96 3300005456 Ga0070678_100245874 Ga0070678_1002458742 244
97 3300005543 Ga0070672_100001574 Ga0070672_1000015742 244
98 3300005547 Ga0070693_100301171 Ga0070693_1003011712 244
99 3300005548 Ga0070665_100418316 Ga0070665_1004183162 244
100 3300005563 Ga0068855_100007617 Ga0068855_1000076172 244
101 3300005614 Ga0068856_100009349 Ga0068856_1000093497 244
102 3300005616 Ga0068852_100102521 Ga0068852_1001025212 244
103 3300006195 Ga0075366_10009927 Ga0075366_100099273 244
104 3300006237 Ga0097621_100032029 Ga0097621_1000320292 244
105 3300006237 Ga0097621_100532425 Ga0097621_1005324251 244
106 3300006358 Ga0068871_100130935 Ga0068871_1001309352 244
107 3300009094 Ga0111539_10536513 Ga0111539_105365132 244
108 3300025940 Ga0207691_10001208 Ga0207691_1000120821 244
109 3300025949 Ga0207667_10059241 Ga0207667_100592413 244
110 3300026121 Ga0207683_10243103 Ga0207683_102431032 244
111 3300028556 Ga0265337_1003242 Ga0265337_10032423 244
112 3300028573 Ga0265334_10000212 Ga0265334_1000021217 244
113 3300031240 Ga0265320_10001677 Ga0265320_100016775 244
114 3300031249 Ga0265339_10006727 Ga0265339_100067276 244
115 3300031344 Ga0265316_10000572 Ga0265316_1000057237 244
116 3300031456 Ga0307513_10086536 Ga0307513_100865362 244
117 3300031616 Ga0307508_10125896 Ga0307508_101258962 244
118 3300031711 Ga0265314_10000003 Ga0265314_100000031458 244
119 3300031711 Ga0265314_10116599 Ga0265314_101165992 244
120 3300031727 Ga0316576_10015065 Ga0316576_100150654 244
121 3300031727 Ga0316576_10015495 Ga0316576_100154953 244
122 3300036712 Ga0316584_0068347 Ga0316584_0068347_55_795 244
123 3300041512 Ga0451853_2926981 Ga0451853_2926981_78_815 244
124 3300042007 Ga0439449_0085911 Ga0439449_0085911_17_751 244
125 3300044673 Ga0453683_0334380 Ga0453683_0334380_188_928 244
126 3300046517 Ga0495630_0201741 Ga0495630_0201741_216_950 244
127 3300049539 Ga0501323_004797 Ga0501323_004797_393_1130 244
128 3300049571 Ga0501034_0078082 Ga0501034_0078082_2236_2970 244
129 3300049581 Ga0501047_0224325 Ga0501047_0224325_123_857 244
130 3300049589 Ga0501073_0017292 Ga0501073_0017292_2991_3725 244
131 3300049590 Ga0501074_0004890 Ga0501074_0004890_6879_7613 244
132 3300049669 Ga0501235_009539 Ga0501235_009539_243_980 244
133 3300049742 Ga0501080_0231852 Ga0501080_0231852_902_1636 244
134 3300049744 Ga0501083_0000240 Ga0501083_0000240_15303_16037 244
135 3300049744 Ga0501083_0078938 Ga0501083_0078938_300_1034 244
136 3300049822 Ga0501035_0148406 Ga0501035_0148406_1055_1789 244
137 3300050493 nmdc:mga0k408_20810_c1 nmdc:mga0k408_20810_c1_2922_3659 244
138 3300053088 Ga0500644_0008856 Ga0500644_0008856_163_909 244
139 3300054114 Ga0501084_0017361 Ga0501084_0017361_332_1066 244
140 3300054114 Ga0501084_0552135 Ga0501084_0552135_196_930 244
141 3300059623 Ga0587101_014658 Ga0587101_014658_233_970 244
142 3300060353 Ga0501082_0071016 Ga0501082_0071016_70_807 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

1

217

0.84

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

44

239

0.84

PF12730

ABC2_membrane_4

ABC-2 family transporter protein

15

179

0.66

PF13346

ABC2_membrane_5

ABC-2 family transporter protein

47

238

0.63

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

2

246

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qba-assembly1.cif.gz_E cryoem structure of the abc transporter nosdfy complexed with nitrous oxide reductase nosz 0.7577 2 241
7qba-assembly1.cif.gz_E cryoem structure of the abc transporter nosdfy complexed with nitrous oxide reductase nosz 0.7443 2 241
6xjh-assembly1.cif.gz_A pmtcd abc exporter without the basket domain at c2 symmetry 0.7437 4 235
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.743 4 240
7w02-assembly1.cif.gz_A cryo-em structure of atp-bound abca3 0.7382 54 235
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7418 50 238 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6875 50 237 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6732 50 237 3.40.1710.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6246 4 237 1.10.3720.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6159 4 237 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1V5XBH0-F1-model_v4 ABC-2 family transporter protein 0.9723 4 244 GO:0005886
GO:0140359
AF-A0A7Y5DXT5-F1-model_v4 ABC transporter permease 0.962 4 244 GO:0005886
GO:0140359
AF-A0A7R6PKG5-F1-model_v4 Antibiotic transport system permease protein 0.9606 4 242 GO:0005886
GO:0140359
AF-A0A7T9DEP9-F1-model_v4 deleted 0.9602 55 243
AF-A0A661DVF5-F1-model_v4 ABC transporter permease 0.96 55 241 GO:0005886
GO:0140359

Feature Viewer

pLDDT pTM Quality
79.23 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map